5OSB: GLIC-GABAAR alpha1 chimera crystallized

GLIC-GABAAR alpha1 chimera crystallized in complex with THDOC at pH4.5. Determined by X-ray diffraction at 3.8 Å resolution. Released 11 Oct 2017.

Method: X-ray diffraction
Resolution: 3.8 Å
Organisms: Gloeobacter violaceus (strain PCC 7421), Mus musculus
Chains: 5
Atoms: 12,561
Mol. weight: 195.26 kDa
Ligands: A8Z
Released: 11 Oct 2017

Explore 5OSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OSB contains 61 α-helices and 61 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	13-14	2
β-strand	15-30	16	1
β-strand	35-47	13	1
α-helix	49-51	3
β-strand	64	1	1
β-strand	75-77	3	2
β-strand	80	1	1
α-helix	83-84	2
β-strand	85-93	9	1
β-strand	98-110	13	1
β-strand	122-132	11	2
β-strand	139-143	5	1
α-helix	145-147	3
β-strand	149-150	2	1
β-strand	159-175	17	2
β-strand	178-191	14	2
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-414	30

Chains B and D: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	14	1
β-strand	15-30	16	3
β-strand	35-47	13	3
α-helix	49-51	3
β-strand	64	1	3
β-strand	75-77	3	4
β-strand	80	1	3
α-helix	83-84	2
β-strand	85-93	9	3
β-strand	98-110	13	3
β-strand	122-132	11	4
β-strand	139-143	5	3
α-helix	145-147	3
β-strand	149-150	2	3
β-strand	159-175	17	4
β-strand	178-191	14	4
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-414	30

Chain C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	14	1
β-strand	15-30	16	5
β-strand	35-47	13	5
α-helix	49-51	3
β-strand	75-77	3	6
β-strand	80	1	5
α-helix	83-84	2
β-strand	85-93	9	5
β-strand	98-110	13	5
β-strand	122-132	11	6
α-helix	133-134	2
β-strand	139-143	5	5
α-helix	145-147	3
β-strand	149-150	2	5
β-strand	159-166	8	6
β-strand	171-175	5	6
β-strand	178-191	14	6
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-413	29

Chain E: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	13-14	2
β-strand	15-30	16	9
β-strand	35-47	13	9
α-helix	49-51	3
β-strand	64	1	9
β-strand	75-77	3	10
β-strand	80	1	9
α-helix	83-84	2
β-strand	85-93	9	9
β-strand	98-110	13	9
β-strand	122-132	11	10
β-strand	139-143	5	9
α-helix	145-147	3
β-strand	149-150	2	9
β-strand	159-166	8	10
β-strand	171-175	5	10
β-strand	178-191	14	10
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-414	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proton-gated ion channel,Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid…	A, B, C, D, E	protein	336	Gloeobacter violaceus (strain PCC 7421), Mus musculus	P62812 (AlphaFold model), Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5OSB_1 Proton-gated ion channel,Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, B, C, D, E)
QDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGV
RVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPF
DSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLE
SKLDYQLRISRQYGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFVVTTVLTMTTLS
ISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKSQPARAAKIDRLSRIAFP
LLFGIFNLVYWATYLNREPQLKAPTPHQHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A8Z	Tetrahydrodeoxycorticosterone	C21 H34 O3	5

Water and common crystallization additives (ACT, CL) are not listed.

Primary citation

Crystal structures of a GABAA-receptor chimera reveal new endogenous neurosteroid-binding sites. Laverty, D., Thomas, P., Field, M. et al. Nat Struct Mol Biol (2017) 24:977-985. DOI 10.1038/nsmb.3477 · PubMed

Other PDB entries of the same protein (UniProt P62812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FOI 2.5 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
8G4X 2.56 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
8G5F 2.64 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G4N 2.67 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSA 2.75 Å, GLIC-GABAAR alpha1 chimera crystallized at pH4.6
8G5H 2.89 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G5G 2.94 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
8G4O 3.06 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSC 3.1 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with pregnenolone sulfate at pH 4.5

Browse structure collections

About this viewer

MolViewer shows 5OSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.