8GO9: Beta-arrestin2

Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human Atypical chemokine receptor 2, ACKR2 (D6R). Determined by electron microscopy at 3.35 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 3.35 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 8
Atoms: 11,662
Mol. weight: 197.04 kDa
Released: 27 Dec 2023

Explore 8GO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GO9 contains 32 α-helices and 128 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
β-strand	20-23	4	1
β-strand	27-30	4	2
β-strand	35	1	2
β-strand	38-43	6	1
α-helix	46-49	4
β-strand	53-63	11	3
β-strand	78-86	9	3
α-helix	100-109	10
β-strand	113-118	6	1
β-strand	128-130	3	4
α-helix	131-133	3
β-strand	142-152	11	3
α-helix	158-159	2
β-strand	165-169	5	3
β-strand	170-173	4	2
α-helix	181-183	3
β-strand	184-189	6	5
β-strand	198-203	6	5
β-strand	208-209	2	6
β-strand	215-223	9	5
β-strand	229-243	15	7
β-strand	248-259	12	7
β-strand	263	1	7
β-strand	267-275	9	5
β-strand	289-291	3	4
α-helix	292-293	2
β-strand	301	1	4
α-helix	302-304	3
β-strand	317-330	14	7
β-strand	336-342	7	7
β-strand	343-344	2	6
α-helix	346-349	4
α-helix	394-407	14

Chains B and D: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	13-15	3	9
β-strand	20-28	9	8
β-strand	35-42	8	9
β-strand	48-55	8	9
β-strand	60-63	4	9
β-strand	71-76	6	8
β-strand	81-87	7	8
α-helix	91-93	3
β-strand	95-99	5	9
β-strand	101	1	10
β-strand	102-103	2	9
β-strand	112	1	10
β-strand	117-121	5	9
β-strand	127	1	11
β-strand	130-134	5	12
β-strand	147-155	9	12
β-strand	156	1	11
β-strand	161-163	3	13
β-strand	173-175	3	12
α-helix	176-178	3
β-strand	179-180	2	12
β-strand	186-193	8	12
β-strand	207-210	4	13
β-strand	215-218	4	13

Chains C and E: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	14
β-strand	11-14	4	15
β-strand	20-26	7	14
β-strand	34-39	6	15
β-strand	46-50	5	15
β-strand	54-55	2	15
α-helix	56	1
β-strand	63-68	6	14
β-strand	71-76	6	14
β-strand	86-91	6	15
α-helix	97	1
β-strand	98	1	15
β-strand	104-107	4	15
β-strand	117-119	3	16
α-helix	120-122	3
α-helix	123-127	5
β-strand	130-140	11	16
β-strand	160-164	5	16
β-strand	174-183	10	16
α-helix	184-189	6

Chains G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	350-353	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, F	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	B, D	protein	237	Mus musculus
Fab30 Light Chain	C, E	protein	215	Mus musculus
Atypical chemokine receptor 2	G, H	protein	18	Homo sapiens	O00590 (AlphaFold model)

Sequence of entity 1 (A, F), FASTA

>8GO9_1 Beta-arrestin-2 (chains A, F)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (B, D), FASTA

>8GO9_2 Fab30 Heavy Chain (chains B, D)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (C, E), FASTA

>8GO9_3 Fab30 Light Chain (chains C, E)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, H), FASTA

>8GO9_4 Atypical chemokine receptor 2 (chains G, H)
GTAQASLSSCSESSILTA

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8GO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.