8GOC: Beta-arrestin2

Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human Vasopressin V2 receptor, V2R. Determined by electron microscopy at 4.18 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 4.18 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 12
Atoms: 16,942
Mol. weight: 299.87 kDa
Released: 17 May 2023

Explore 8GOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GOC contains 48 α-helices and 196 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	19-23	5	1
β-strand	27-29	3	2
β-strand	30	1	3
β-strand	35	1	3
α-helix	36-37	2
β-strand	39-44	6	1
α-helix	46-49	4
β-strand	53-61	9	4
β-strand	73	1	5
β-strand	79-88	10	4
α-helix	100-109	10
β-strand	113-117	5	1
β-strand	128-130	3	6
α-helix	131-133	3
β-strand	144	1	4
β-strand	147-152	6	4
α-helix	158-159	2
β-strand	165-167	3	4
β-strand	170-172	3	2
α-helix	181-183	3
β-strand	184-189	6	7
β-strand	198-203	6	7
β-strand	208-209	2	8
β-strand	215-223	9	7
β-strand	229-243	15	9
β-strand	247-259	13	9
β-strand	263	1	9
β-strand	267-275	9	7
β-strand	289-291	3	6
α-helix	292-293	2
β-strand	301	1	6
α-helix	302-304	3
α-helix	306-308	3
β-strand	318-330	13	9
β-strand	336-342	7	9
β-strand	343-344	2	8

Chain B: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	10
β-strand	19-23	5	10
β-strand	27-29	3	11
β-strand	30	1	12
β-strand	35	1	12
α-helix	36-37	2
β-strand	38-44	7	10
α-helix	46-49	4
β-strand	53-61	9	13
β-strand	73	1	9
β-strand	79-88	10	13
α-helix	100-109	10
β-strand	113-118	6	10
β-strand	128-130	3	14
α-helix	131-133	3
β-strand	144-152	9	13
α-helix	158-159	2
β-strand	165-167	3	13
β-strand	170-172	3	11
α-helix	181-183	3
β-strand	184-190	7	15
β-strand	197-203	7	15
β-strand	215-223	9	15
β-strand	229-243	15	16
β-strand	247-259	13	16
β-strand	263	1	16
β-strand	267-275	9	15
β-strand	289-291	3	14
α-helix	292-293	2
β-strand	301	1	14
α-helix	302-304	3
α-helix	306-308	3
β-strand	318-330	13	16
β-strand	336-342	7	16

Chain C: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	17
β-strand	19-23	5	17
β-strand	27-29	3	18
β-strand	30	1	19
β-strand	35	1	19
α-helix	36-37	2
β-strand	38-44	7	17
α-helix	46-48	3
β-strand	53-61	9	20
β-strand	73	1	16
β-strand	79-88	10	20
α-helix	100-109	10
β-strand	113-118	6	17
β-strand	128-130	3	21
α-helix	131-133	3
β-strand	144	1	20
β-strand	147-152	6	20
α-helix	158-159	2
β-strand	165-167	3	20
β-strand	170-172	3	18
α-helix	181-183	3
β-strand	184-190	7	22
β-strand	197-204	8	22
β-strand	215-223	9	22
β-strand	229-243	15	23
β-strand	247-249	3	23
β-strand	250	1	5
β-strand	252-259	8	23
β-strand	263	1	23
β-strand	267-275	9	22
β-strand	289-291	3	21
α-helix	292-293	2
β-strand	301	1	21
α-helix	302-304	3
α-helix	306-308	3
β-strand	318-330	13	23
β-strand	336-342	7	23

Chain D: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	24
β-strand	13-15	3	25
β-strand	20-28	9	24
β-strand	35-42	8	25
β-strand	49-55	7	25
β-strand	60-63	4	25
α-helix	65-67	3
β-strand	71-76	6	24
β-strand	81-87	7	24
α-helix	91-93	3
β-strand	95-103	9	25
β-strand	112-113	2	25
β-strand	117-121	5	25
β-strand	127	1	26
β-strand	130-134	5	27
β-strand	148-155	8	27
β-strand	156	1	26
β-strand	161-163	3	28
β-strand	173-180	8	27
β-strand	186-192	7	27
β-strand	207-210	4	28
β-strand	215-218	4	28

Chains E and L: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	29
β-strand	11-14	4	30
β-strand	20-26	7	29
β-strand	34-39	6	30
β-strand	45-50	6	30
β-strand	54-55	2	30
α-helix	56	1
β-strand	63-68	6	29
β-strand	71-76	6	29
β-strand	86-91	6	30
α-helix	97	1
β-strand	98-99	2	30
β-strand	103-107	5	30
β-strand	115-119	5	31
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	31
β-strand	160-164	5	31
β-strand	168	1	32
β-strand	173	1	32
β-strand	174-183	10	31
α-helix	184-188	5

Chains G, U and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-362	2	1

Chain H: 2 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	33
β-strand	13-15	3	34
β-strand	20-28	9	33
β-strand	35-42	8	34
β-strand	49-55	7	34
β-strand	60-63	4	34
α-helix	65-67	3
β-strand	71	1	33
β-strand	74-76	3	33
β-strand	81-87	7	33
α-helix	91-93	3
β-strand	95-103	9	34
β-strand	112-113	2	34
β-strand	117-121	5	34
β-strand	127	1	35
β-strand	130-134	5	36
β-strand	148-155	8	36
β-strand	156	1	35
β-strand	161-163	3	37
β-strand	173-180	8	36
β-strand	186-192	7	36
β-strand	207-210	4	37
β-strand	215-218	4	37

Chain M: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	42
β-strand	13-15	3	43
β-strand	20-28	9	42
β-strand	35-42	8	43
β-strand	48-55	8	43
β-strand	60-63	4	43
α-helix	65-67	3
β-strand	71-76	6	42
β-strand	81-87	7	42
α-helix	91-93	3
β-strand	95-103	9	43
β-strand	112-113	2	43
β-strand	117-121	5	43
β-strand	127	1	44
β-strand	130-134	5	45
β-strand	148-155	8	45
β-strand	156	1	44
β-strand	161-163	3	46
β-strand	173-180	8	45
β-strand	186-192	7	45
β-strand	207-210	4	46
β-strand	215-218	4	46

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B, C	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	D, H, M	protein	237	Mus musculus
Fab30 Light Chain	E, L, N	protein	215	Mus musculus
Vasopressin V2 receptor	G, U, V	protein	29	Homo sapiens	P30518 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8GOC_1 Beta-arrestin-2 (chains A, B, C)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (D, H, M), FASTA

>8GOC_2 Fab30 Heavy Chain (chains D, H, M)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (E, L, N), FASTA

>8GOC_3 Fab30 Light Chain (chains E, L, N)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, U, V), FASTA

>8GOC_4 Vasopressin V2 receptor (chains G, U, V)
ARGRTPPSLGPQDESCTTASSSLAKDTSS

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8GOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.