8GOO: Beta-arrestin2

Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human C5a anaphylatoxin chemotactic receptor 1, C5aR1. Determined by electron microscopy at 4.4 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 4.4 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 12
Atoms: 16,966
Mol. weight: 296.59 kDa
Released: 17 May 2023

Explore 8GOO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GOO contains 45 α-helices and 192 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	20-23	4	1
β-strand	27-30	4	2
β-strand	35	1	2
β-strand	38-43	6	1
β-strand	53-63	11	3
β-strand	77	1	4
β-strand	78-88	11	3
α-helix	90-92	3
α-helix	100-109	10
β-strand	113-118	6	1
β-strand	128-130	3	3
α-helix	131-133	3
β-strand	142-152	11	3
α-helix	158-159	2
β-strand	165-167	3	3
β-strand	170-173	4	2
α-helix	181-183	3
β-strand	184-190	7	5
β-strand	197-203	7	5
β-strand	208-209	2	6
β-strand	215-223	9	5
β-strand	229-243	15	7
β-strand	247-259	13	7
β-strand	263	1	7
β-strand	267-275	9	5
α-helix	280-282	3
β-strand	289-291	3	3
α-helix	292-293	2
β-strand	301	1	3
α-helix	302-303	2
α-helix	305-308	4
β-strand	318-330	13	7
β-strand	336-342	7	7
β-strand	343-344	2	6

Chain B: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	8
β-strand	20-23	4	8
β-strand	27-30	4	9
β-strand	35	1	9
β-strand	38-43	6	8
β-strand	53-63	11	10
β-strand	77	1	7
β-strand	78-88	11	10
α-helix	90-92	3
α-helix	100-109	10
β-strand	113-118	6	8
β-strand	128-130	3	10
α-helix	131-133	3
β-strand	142-152	11	10
α-helix	158-159	2
β-strand	165-167	3	10
β-strand	170-173	4	9
α-helix	181-183	3
β-strand	184-190	7	11
β-strand	197-203	7	11
β-strand	208-209	2	12
β-strand	215-223	9	11
β-strand	229-243	15	13
β-strand	247-259	13	13
β-strand	263	1	13
β-strand	267-275	9	11
α-helix	280-282	3
β-strand	289-291	3	10
α-helix	292-293	2
β-strand	301	1	10
α-helix	302-303	2
α-helix	305-307	3
β-strand	318-330	13	13
β-strand	336-342	7	13
β-strand	343-344	2	12

Chain C: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	14
β-strand	20-23	4	14
β-strand	27-30	4	15
β-strand	35	1	15
β-strand	38-43	6	14
β-strand	53-63	11	16
β-strand	77	1	13
β-strand	78-88	11	16
α-helix	90-92	3
α-helix	100-109	10
β-strand	113-118	6	14
β-strand	128-130	3	16
α-helix	131-133	3
β-strand	142-152	11	16
α-helix	158-159	2
β-strand	165-167	3	16
β-strand	170-173	4	15
α-helix	181-183	3
β-strand	184-190	7	17
β-strand	197-203	7	17
β-strand	208-209	2	18
β-strand	215-223	9	17
β-strand	229-243	15	4
β-strand	247-259	13	4
β-strand	263	1	4
β-strand	267-275	9	17
α-helix	280-282	3
β-strand	289-291	3	16
α-helix	292-293	2
β-strand	301	1	16
α-helix	302-303	2
α-helix	305-307	3
β-strand	318-330	13	4
β-strand	336-342	7	4
β-strand	343-344	2	18

Chains D, H and M: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	19
β-strand	13-15	3	20
β-strand	20-28	9	19
β-strand	35-42	8	20
β-strand	48-55	8	20
β-strand	60-63	4	20
α-helix	65-67	3
β-strand	71-76	6	19
β-strand	81-87	7	19
α-helix	91-93	3
β-strand	95-103	9	20
β-strand	112-113	2	20
β-strand	117-121	5	20
β-strand	127	1	21
β-strand	130-134	5	22
β-strand	148-155	8	22
β-strand	156	1	21
β-strand	161-163	3	23
β-strand	173-180	8	22
β-strand	186-192	7	22
β-strand	207-210	4	23
β-strand	215-218	4	23

Chains E, L and N: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	24
β-strand	12-14	3	25
β-strand	20-26	7	24
β-strand	34-39	6	26
β-strand	45-50	6	26
β-strand	54-55	2	26
α-helix	56	1
β-strand	63-68	6	24
β-strand	71-76	6	24
β-strand	86-91	6	26
β-strand	98-99	2	26
β-strand	105-107	3	25
β-strand	115-119	5	27
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	27
β-strand	160-164	5	27
β-strand	168	1	28
β-strand	173	1	28
β-strand	174-183	10	27
α-helix	184-189	6

Chains G and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	337-339	3	1

Chain U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	337	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B, C	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	D, H, M	protein	237	Mus musculus
Fab30 Light Chain	E, L, N	protein	215	Mus musculus
C5a anaphylatoxin chemotactic receptor 1	G, U, V	protein	20	Homo sapiens	P21730 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8GOO_1 Beta-arrestin-2 (chains A, B, C)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (D, H, M), FASTA

>8GOO_2 Fab30 Heavy Chain (chains D, H, M)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (E, L, N), FASTA

>8GOO_3 Fab30 Light Chain (chains E, L, N)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, U, V), FASTA

>8GOO_4 C5a anaphylatoxin chemotactic receptor 1 (chains G, U, V)
ESKSFTRSTVDTMAQKTQAV

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8GOO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.