Crystal structure of Galectin-8 C-CRD with part of linker. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Jul 2023.
Explore 8HL9 in 3D Show helices and sheets RCSB PDB PDBe
8HL9 contains 1 α-helix and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-24 | 3 | 1 |
| β-strand | 35-39 | 5 | 1 |
| β-strand | 48-55 | 8 | 2 |
| β-strand | 61-67 | 7 | 1 |
| β-strand | 74-81 | 8 | 1 |
| β-strand | 86-93 | 8 | 1 |
| β-strand | 96-97 | 2 | 1 |
| β-strand | 101 | 1 | 1 |
| β-strand | 114-121 | 8 | 2 |
| β-strand | 125-130 | 6 | 2 |
| β-strand | 133-139 | 7 | 2 |
| α-helix | 145-147 | 3 | |
| β-strand | 150-155 | 6 | 1 |
| β-strand | 157-164 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-8 | A | protein | 147 | Homo sapiens | O00214 (AlphaFold model) |
>8HL9_1 Galectin-8 (chains A) SRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHL NPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEY KHRFKELSSIDTLEINGDIHLLEVRSW
Linker remodels human Galectin-8 structure and regulates its hemagglutination and pro-apoptotic activity. Si, Y., Cai, J., Zhu, J. et al. Int J Biol Macromol (2023) 245:125456-125456. DOI 10.1016/j.ijbiomac.2023.125456 · PubMed
Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.