8HPP: Human INTS3 with SAGE1

Crystal structure of human INTS3 with SAGE1. Determined by X-ray diffraction at 3.0 Å resolution. Released 20 Dec 2023.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,102
Mol. weight: 118.69 kDa
Released: 20 Dec 2023

Explore 8HPP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HPP contains 58 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	573-575	3
α-helix	576-579	4
α-helix	584-587	4
α-helix	591-603	13
α-helix	615-626	12
α-helix	641-647	7
α-helix	651-660	10
α-helix	669-679	11
α-helix	686-696	11
α-helix	705-711	7
α-helix	719-733	15
α-helix	735-748	14
α-helix	750-753	4
α-helix	758-763	6
α-helix	769-781	13
α-helix	789-799	11
α-helix	804-817	14
α-helix	825-829	5
α-helix	837-847	11
α-helix	851-853	3
α-helix	854-862	9
α-helix	871-882	12
α-helix	884-899	16
α-helix	913-933	21
α-helix	934-936	3
α-helix	945-955	11
α-helix	962-964	3
α-helix	967-971	5

Chain B: 26 helices, 0 β-strands

Element	Residues	Length
α-helix	592-595	4
α-helix	599-603	5
α-helix	620-623	4
α-helix	627-630	4
α-helix	641-648	8
α-helix	651-653	3
α-helix	654-661	8
α-helix	668-682	15
α-helix	686-696	11
α-helix	705-713	9
α-helix	719-733	15
α-helix	735-748	14
α-helix	750-753	4
α-helix	758-763	6
α-helix	769-780	12
α-helix	789-799	11
α-helix	804-815	12
α-helix	821-830	10
α-helix	837-847	11
α-helix	854-862	9
α-helix	871-900	30
α-helix	914-934	21
α-helix	945-953	9
α-helix	960-963	4
α-helix	967-970	4
α-helix	971-973	3

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	818-835	18
α-helix	843-849	7
α-helix	856-872	17
α-helix	876-899	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 3	A, B	protein	471	Homo sapiens	Q68E01 (AlphaFold model)
Sarcoma antigen 1	C	protein	90	Homo sapiens	Q9NXZ1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HPP_1 Integrator complex subunit 3 (chains A, B)
DQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVLASCLQELFKAHFR
GEVLPEEITEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLL
YYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPD
ETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAW
QLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQF
TTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLR
LNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAA
LSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD

Sequence of entity 2 (C), FASTA

>8HPP_2 Sarcoma antigen 1 (chains C)
PGSAMAKKINDDIKYQLMKEVRRFGQNYERIFILLEEVQGSMKVKRQFVEFTIKEAARFK
KVVLIQQLEKALKEIDSHCHLRKVKHMRKR

Primary citation

Cancer-testis antigen SAGE1 is a pan-cancer master regulator of RNA polymerase II. Deng, W., Wu, J., Lei, M. To be published.

Other PDB entries of the same protein (UniProt Q68E01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
4OWX 2.3 Å, Structural basis of SOSS1 in complex with a 12nt ssDNA
7BV7 2.4 Å, INTS3 complexed with INTS6
6WLG 3.11 Å, Ints3 C-terminal Domain
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 8HPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.