8IY6: ETB-Gi complex

ETB-Gi complex bound to Endotheline-1, focused on receptor. Determined by electron microscopy at 3.13 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 3.13 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,495
Mol. weight: 69.99 kDa
Released: 16 Aug 2023

Explore 8IY6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IY6 contains 13 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2	1	1
α-helix	9-17	9

Chain R: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	98-128	31
α-helix	130-132	3
α-helix	135-164	30
α-helix	171-204	34
α-helix	219-232	14
α-helix	234-239	6
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-277	14
α-helix	278-282	5
α-helix	283-302	20
α-helix	319-349	31
α-helix	358-389	32
α-helix	391-402	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin type B receptor	R	protein	609	Homo sapiens	P24530 (AlphaFold model)
Endothelin-1	L	protein	21	Homo sapiens	P05305 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>8IY6_1 Endothelin type B receptor (chains R)
EERGFPPDRATPLLQTAEIMTPPTKTLWPKGDYKDDDDKLAPAEVPKGDRTAGSPPRTIS
PPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALG
DLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASW
SRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFM
QFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVF
CLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIAL
YLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSSGSGG
GGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGE
NALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNY
FGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINSGGSGGGGSGGSS
SGGLEVLFQ

Sequence of entity 2 (L), FASTA

>8IY6_2 Endothelin-1 (chains L)
CSCSSLMDKECVYFCHLDIIW

Primary citation

Cryo-EM structure of the endothelin-1-ET B -G i complex. Sano, F.K., Akasaka, H., Shihoya, W. et al. Elife (2023) 12. DOI 10.7554/eLife.85821 · PubMed

Other PDB entries of the same protein (UniProt P24530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IGK 2.0 Å, Crystal Structure of human ETB receptor in complex with Endothelin-3
5X93 2.2 Å, Human endothelin receptor type-B in complex with antagonist K-8794
5GLI 2.5 Å, Human endothelin receptor type-B in the ligand-free form
6IGL 2.7 Å, Crystal Structure of human ETB receptor in complex with IRL1620
6K1Q 2.7 Å, Human endothelin receptor type-B in complex with inverse agonist IRL2500
5GLH 2.8 Å, Human endothelin receptor type-B in complex with ET-1
8IY5 2.8 Å, ETB-Gi complex bound to endothelin-1
8HBD 2.99 Å, Cryo-EM structure of IRL1620-bound ETBR-Gi complex
6LRY 3.0 Å, Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b
8XVE 3.0 Å, Cryo-EM structure of ETBR bound with BQ3020
8XGR 3.2 Å, ETB-eGt complex bound to endothelin-1
8XWP 3.21 Å, Cryo-EM structure of ET-1 bound ETBR-DNGI complex

Browse structure collections

About this viewer

MolViewer shows 8IY6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.