8J8R: Beta-arrestin2

Structure of beta-arrestin2 in complex with M2Rpp. Determined by electron microscopy at 2.9 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 12
Atoms: 13,424
Mol. weight: 295.58 kDa
Released: 27 Dec 2023

Explore 8J8R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J8R contains 38 α-helices and 147 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	19-23	5	1
β-strand	27-29	3	2
β-strand	30	1	3
β-strand	35	1	3
β-strand	38-44	7	1
α-helix	46-49	4
β-strand	53-64	12	4
β-strand	77-88	12	4
α-helix	98-99	2
α-helix	100-109	10
β-strand	113-118	6	1
β-strand	128-130	3	4
α-helix	131-132	2
β-strand	141-152	12	4
β-strand	164-169	6	4
β-strand	170-172	3	2
α-helix	181-183	3
β-strand	184-190	7	5
β-strand	197-203	7	5
β-strand	208-210	3	6
β-strand	215-224	10	5
β-strand	229-243	15	7
β-strand	247-259	13	7
β-strand	263	1	7
β-strand	267-275	9	5
α-helix	280-282	3
β-strand	289-291	3	4
α-helix	292-293	2
β-strand	301	1	4
α-helix	302-304	3
β-strand	318-330	13	7
β-strand	336-342	7	7
β-strand	343-345	3	6
α-helix	346-349	4

Chain B: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	8
β-strand	19-23	5	8
β-strand	27-29	3	9
β-strand	30	1	10
β-strand	35	1	10
α-helix	36-37	2
β-strand	38-44	7	8
β-strand	53-64	12	11
β-strand	77-88	12	11
α-helix	100-109	10
α-helix	110-112	3
β-strand	113-118	6	8
β-strand	128-130	3	11
α-helix	131-132	2
β-strand	141-152	12	11
α-helix	158-159	2
β-strand	164-169	6	11
β-strand	170-172	3	9
α-helix	181-183	3
β-strand	184-189	6	12
β-strand	198-204	7	12
β-strand	208-209	2	13
β-strand	215-223	9	12
β-strand	229-242	14	14
β-strand	248-259	12	14
β-strand	263	1	14
β-strand	267-275	9	12
β-strand	289-291	3	11
α-helix	292-293	2
β-strand	301	1	11
α-helix	302-304	3
β-strand	318-330	13	14
β-strand	336-342	7	14
β-strand	343-344	2	13
α-helix	346-349	4

Chain C: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	15
β-strand	19-23	5	15
β-strand	27-29	3	16
β-strand	30	1	17
β-strand	35	1	17
β-strand	40-44	5	15
α-helix	46-49	4
β-strand	53-64	12	18
β-strand	77-88	12	18
α-helix	98-99	2
α-helix	100-109	10
β-strand	113-116	4	15
β-strand	128-130	3	18
α-helix	131-132	2
β-strand	141-152	12	18
α-helix	161-163	3
β-strand	164-169	6	18
β-strand	170-172	3	16
α-helix	181-183	3
β-strand	184-190	7	19
β-strand	197-204	8	19
β-strand	208-209	2	20
β-strand	215-224	10	19
β-strand	229-241	13	21
β-strand	249-259	11	21
β-strand	263	1	21
β-strand	267-275	9	19
β-strand	289-291	3	18
α-helix	292-293	2
β-strand	301	1	18
α-helix	302-304	3
β-strand	319-330	12	21
β-strand	336-342	7	21
β-strand	343-344	2	20
α-helix	346-349	4

Chains D and H: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	22
β-strand	13-15	3	23
β-strand	20-28	9	22
β-strand	35-42	8	23
β-strand	48-55	8	23
β-strand	60-63	4	23
β-strand	71-76	6	22
β-strand	81-87	7	22
α-helix	91-93	3
β-strand	95-103	9	23
β-strand	112-113	2	23
β-strand	117-121	5	23

Chains E and L: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-8	4	24
β-strand	11-13	3	25
β-strand	20-26	7	24
β-strand	34-39	6	25
β-strand	46-50	5	25
β-strand	54-55	2	25
α-helix	56	1
β-strand	63-68	6	24
β-strand	71-76	6	24
β-strand	85-91	7	25
α-helix	97	1
β-strand	98-99	2	25
β-strand	103-106	4	25

Chain G: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-363	3	1

Chain M: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	30
β-strand	13-15	3	31
β-strand	20-28	9	30
β-strand	35-42	8	31
β-strand	49-55	7	31
β-strand	60-63	4	31
β-strand	71-76	6	30
β-strand	81-87	7	30
α-helix	91-93	3
β-strand	95-103	9	31
β-strand	112-113	2	31
β-strand	117-121	5	31

Chain N: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	32
β-strand	11-13	3	33
β-strand	20-25	6	32
β-strand	34-39	6	33
β-strand	46-50	5	33
β-strand	54-55	2	33
α-helix	56	1
β-strand	63-68	6	32
β-strand	71-76	6	32
β-strand	86-91	6	33
α-helix	97	1
β-strand	99	1	33
β-strand	103-106	4	33

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B, C	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	D, H, M	protein	237	Mus musculus
Fab30 Light Chain	E, L, N	protein	215	Mus musculus
Muscarinic acetylcholine receptor M2	G, U, V	protein	18	Homo sapiens	P08172 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8J8R_1 Beta-arrestin-2 (chains A, B, C)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (D, H, M), FASTA

>8J8R_2 Fab30 Heavy Chain (chains D, H, M)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (E, L, N), FASTA

>8J8R_3 Fab30 Light Chain (chains E, L, N)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, U, V), FASTA

>8J8R_4 Muscarinic acetylcholine receptor M2 (chains G, U, V)
EITQDENTVSTSLGHSKD

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8J8R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.