8J9S: Leucine zipper complex of AIMP1 and AIMP2

leucine zipper complex of AIMP1 and AIMP2. Determined by X-ray diffraction at 3.01 Å resolution. Released 8 May 2024.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,380
Mol. weight: 24.55 kDa
Released: 8 May 2024

Explore 8J9S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J9S contains 3 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-72	67

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-70	65

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	52-79	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aminoacyl tRNA synthase complex-interacting multifunctional protein 1	A, B	protein	79	Homo sapiens	Q12904 (AlphaFold model)
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2	C	protein	49	Homo sapiens	Q13155 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8J9S_1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (chains A, B)
MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIE
ELKQELIQAEIQNGVKQIP

Sequence of entity 2 (C), FASTA

>8J9S_2 Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (chains C)
MSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTLEHHHHHH

Primary citation

Assembly of the Human Multi-tRNA Synthetase Complex Through Leucine Zipper Motifs. Kim, D.K., Lee, K., Kang, B.S. J Mol Biol (2024) 436:168865-168865. DOI 10.1016/j.jmb.2024.168865 · PubMed

Other PDB entries of the same protein (UniProt Q12904 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FL0 1.5 Å, Crystal structure of the EMAP2/RNA-binding domain of the P43 protein from human…
1EUJ 1.8 Å, A novel anti-tumor cytokine contains a RNA-binding motif present in aminoacyl-tRNA…
1E7Z 2.05 Å, Crystal structure of the EMAP2/RNA binding domain of the p43 protein from human…
4R3Z 4.03 Å, Crystal structure of human ArgRS-GlnRS-AIMP1 complex
8ONG Structure of the endothelial monocyte activating polypeptide II (EMAP II) in solution

Browse structure collections

About this viewer

MolViewer shows 8J9S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.