8JFL: PhK holoenzyme in active state, muscle isoform

PhK holoenzyme in active state, muscle isoform. Determined by electron microscopy at 2.9 Å resolution. Released 3 Apr 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 12
Atoms: 65,884
Mol. weight: 1233.71 kDa
Ligands: ADP, FAR
Released: 3 Apr 2024

Explore 8JFL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JFL contains 465 α-helices and 324 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	23-25	3
β-strand	42-43	2	1
α-helix	44-50	7
α-helix	52-62	11
α-helix	68-93	26
α-helix	96-104	9
α-helix	108-110	3
α-helix	112-113	2
β-strand	115-116	2	1
α-helix	127-129	3
α-helix	135-149	15
α-helix	159-171	13
β-strand	180	1	2
β-strand	196	1	2
α-helix	199-211	13
α-helix	232-245	14
β-strand	250	1	3
β-strand	253	1	3
β-strand	256	1	4
α-helix	257-259	3
α-helix	260-263	4
α-helix	273-286	14
β-strand	288-289	2	5
β-strand	292-294	3	5
β-strand	296	1	4
α-helix	325-326	2
β-strand	327-328	2	5
α-helix	330-337	8
β-strand	372-374	3	5
α-helix	377-379	3
α-helix	380-385	6
α-helix	392	1
β-strand	393-395	3	5
α-helix	401-414	14
α-helix	420-423	4
α-helix	428-430	3
α-helix	434-438	5
β-strand	440-446	7	6
α-helix	449-457	9
β-strand	463-464	2	6
β-strand	472-474	3	7
α-helix	476-483	8
β-strand	489	1	8
β-strand	494	1	8
α-helix	506-508	3
β-strand	511-513	3	7
β-strand	516-520	5	7
α-helix	523-526	4
α-helix	531-533	3
α-helix	536-553	18
β-strand	559	1	9
β-strand	561-566	6	6
α-helix	568-570	3
β-strand	571	1	10
β-strand	578	1	10
α-helix	580-590	11
β-strand	593-594	2	11
β-strand	597-598	2	11
β-strand	599-601	3	6
α-helix	606-608	3
β-strand	611	1	9
β-strand	614-615	2	7
α-helix	617-619	3
α-helix	767-770	4
α-helix	782-788	7
α-helix	789-793	5
β-strand	799	1	12
β-strand	805	1	12
α-helix	806-820	15
α-helix	823-832	10
α-helix	840-849	10
β-strand	853-855	3	13
β-strand	866-867	2	13
α-helix	873-883	11
α-helix	891-907	17
α-helix	909-912	4
β-strand	915	1	14
β-strand	917-919	3	13
α-helix	920-933	14
α-helix	939-945	7
α-helix	951-963	13
α-helix	1053-1063	11
β-strand	1066	1	14
α-helix	1071-1081	11
β-strand	1084-1087	4	15
β-strand	1090-1093	4	15
α-helix	1094-1096	3
α-helix	1107-1114	8
α-helix	1121-1140	20
β-strand	1149-1150	2	15
α-helix	1151-1169	19
α-helix	1186-1190	5
β-strand	1194	1	16
α-helix	1199-1207	9

Chain B: 57 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	70-72	3
β-strand	81-83	3	67
α-helix	84-101	18
α-helix	110-131	22
α-helix	134-141	8
α-helix	149-150	2
β-strand	152-154	3	67
β-strand	160	1	67
α-helix	172-188	17
α-helix	196-210	15
α-helix	211-214	4
β-strand	217	1	68
β-strand	233	1	68
α-helix	236-249	14
β-strand	253	1	69
α-helix	261-263	3
β-strand	264	1	69
α-helix	269-280	12
α-helix	296-300	5
α-helix	310-324	15
β-strand	325	1	70
β-strand	330-331	2	70
α-helix	350-351	2
α-helix	354-358	5
β-strand	364-365	2	70
α-helix	367-378	12
α-helix	382-395	14
β-strand	397-398	2	71
β-strand	404-405	2	71
β-strand	410-411	2	70
α-helix	412-413	2
α-helix	414-416	3
α-helix	417-422	6
β-strand	430-431	2	70
α-helix	442-455	14
α-helix	461-464	4
α-helix	473-475	3
β-strand	484	1	72
β-strand	487	1	72
β-strand	494-495	2	73
β-strand	498-501	4	74
α-helix	504-512	9
β-strand	518	1	74
β-strand	526-529	4	75
α-helix	531-538	8
β-strand	544	1	76
β-strand	549	1	76
β-strand	565-568	4	75
β-strand	571-575	5	75
α-helix	578-580	3
α-helix	586-589	4
α-helix	591-608	18
α-helix	614-615	2
β-strand	618-621	4	74
α-helix	623-626	4
α-helix	628-630	3
α-helix	631-643	13
β-strand	650-651	2	73
α-helix	656-659	4
β-strand	665-668	4	75
α-helix	716-720	5
α-helix	727-730	4
α-helix	737-750	14
β-strand	756	1	77
β-strand	761	1	77
α-helix	762-775	14
α-helix	779-788	10
α-helix	796-805	10
β-strand	809-813	5	78
β-strand	819-822	4	78
α-helix	828-833	6
α-helix	834-839	6
α-helix	845-863	19
α-helix	865-868	4
β-strand	873-875	3	78
α-helix	876-891	16
α-helix	895-898	4
α-helix	899-901	3
α-helix	904-914	11
β-strand	920	1	79
β-strand	922	1	79
α-helix	924-934	11
α-helix	941-950	10
β-strand	956-958	3	80
β-strand	961-963	3	80
α-helix	968-971	4
α-helix	977-986	10
α-helix	987-989	3
α-helix	993-1012	20
β-strand	1016	1	81
β-strand	1022-1023	2	80
α-helix	1024-1043	20
α-helix	1052-1056	5
α-helix	1065-1078	14
β-strand	1082	1	81

Chains C, G, K and O: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	330-335	6
α-helix	341-355	15
α-helix	368-370	3
β-strand	371	1	16
α-helix	376-379	4

Chains E and I: 55 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	23-25	3
β-strand	42-43	2	17
α-helix	44-50	7
α-helix	52-62	11
α-helix	68-93	26
α-helix	96-104	9
α-helix	108-110	3
α-helix	112-113	2
β-strand	115-116	2	17
α-helix	127-129	3
α-helix	135-149	15
α-helix	159-171	13
β-strand	180	1	18
β-strand	196	1	18
α-helix	199-211	13
α-helix	232-245	14
β-strand	250	1	19
β-strand	253	1	19
β-strand	256	1	20
α-helix	257-259	3
α-helix	260-263	4
α-helix	273-286	14
β-strand	288-289	2	21
β-strand	292-294	3	21
β-strand	296	1	20
α-helix	325-326	2
β-strand	327-328	2	21
α-helix	330-337	8
β-strand	372-374	3	21
α-helix	377-379	3
α-helix	380-385	6
α-helix	392	1
β-strand	393-395	3	21
α-helix	401-414	14
α-helix	420-423	4
α-helix	428-430	3
α-helix	434-438	5
β-strand	440-446	7	22
α-helix	449-457	9
β-strand	463-464	2	22
β-strand	472-474	3	23
α-helix	476-483	8
β-strand	489	1	24
β-strand	494	1	24
α-helix	506-508	3
β-strand	511-513	3	23
β-strand	516-520	5	23
α-helix	523-526	4
α-helix	531-533	3
α-helix	536-553	18
β-strand	559	1	25
β-strand	561-566	6	22
α-helix	568-570	3
β-strand	571	1	26
β-strand	578	1	26
α-helix	580-590	11
β-strand	593-594	2	27
β-strand	597-598	2	27
β-strand	599-601	3	22
α-helix	606-608	3
β-strand	611	1	25
β-strand	614-615	2	23
α-helix	617-619	3
α-helix	767-770	4
α-helix	782-788	7
α-helix	789-793	5
β-strand	799	1	28
β-strand	805	1	28
α-helix	806-820	15
α-helix	823-832	10
α-helix	840-849	10
β-strand	853-855	3	29
β-strand	866-867	2	29
α-helix	873-883	11
α-helix	891-907	17
α-helix	909-912	4
β-strand	915	1	30
β-strand	917-919	3	29
α-helix	920-933	14
α-helix	939-945	7
α-helix	951-963	13
α-helix	1053-1063	11
β-strand	1066	1	30
α-helix	1071-1081	11
β-strand	1084-1087	4	31
β-strand	1090-1093	4	31
α-helix	1094-1096	3
α-helix	1107-1114	8
α-helix	1121-1140	20
β-strand	1149-1150	2	31
α-helix	1151-1169	19
β-strand	1178	1	32
β-strand	1185	1	32
α-helix	1186-1190	5
β-strand	1194	1	33
α-helix	1199-1207	9

Chain F: 57 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	70-72	3
β-strand	81-83	3	82
α-helix	84-101	18
α-helix	110-131	22
α-helix	134-141	8
α-helix	149-150	2
β-strand	152-154	3	82
β-strand	160	1	82
α-helix	172-188	17
α-helix	196-210	15
α-helix	211-214	4
β-strand	217	1	83
β-strand	233	1	83
α-helix	236-249	14
β-strand	252-253	2	84
α-helix	261-263	3
β-strand	264-265	2	84
α-helix	269-282	14
α-helix	296-300	5
α-helix	310-324	15
β-strand	325	1	85
β-strand	330-331	2	85
α-helix	350-351	2
α-helix	354-358	5
β-strand	364-365	2	85
α-helix	367-378	12
α-helix	382-395	14
β-strand	397-398	2	86
β-strand	404-405	2	86
β-strand	410-411	2	85
α-helix	412-413	2
α-helix	414-416	3
α-helix	417-422	6
β-strand	430-431	2	85
α-helix	442-455	14
α-helix	461-464	4
α-helix	473-475	3
β-strand	484	1	87
β-strand	487	1	87
β-strand	494-495	2	88
β-strand	498-501	4	89
α-helix	504-512	9
β-strand	518	1	89
β-strand	526-529	4	90
α-helix	531-538	8
β-strand	544	1	91
β-strand	549	1	91
β-strand	565-568	4	90
β-strand	571-575	5	90
α-helix	578-580	3
α-helix	586-589	4
α-helix	591-608	18
α-helix	614-615	2
β-strand	618-621	4	89
α-helix	623-626	4
α-helix	628-630	3
α-helix	631-643	13
β-strand	650-651	2	88
α-helix	656-659	4
β-strand	665-668	4	90
α-helix	716-720	5
α-helix	727-730	4
α-helix	737-750	14
β-strand	756	1	92
β-strand	761	1	92
α-helix	762-775	14
α-helix	779-788	10
α-helix	796-805	10
β-strand	809-813	5	93
β-strand	819-822	4	93
α-helix	828-833	6
α-helix	834-839	6
α-helix	845-863	19
α-helix	865-868	4
β-strand	873-875	3	93
α-helix	876-891	16
α-helix	895-898	4
α-helix	899-901	3
α-helix	904-914	11
β-strand	920	1	94
β-strand	922	1	94
α-helix	924-934	11
α-helix	941-950	10
β-strand	956-958	3	95
β-strand	961-963	3	95
α-helix	968-971	4
α-helix	977-986	10
α-helix	987-989	3
α-helix	993-1012	20
β-strand	1016	1	96
β-strand	1022-1023	2	95
α-helix	1024-1043	20
α-helix	1052-1056	5
α-helix	1065-1078	14
β-strand	1082	1	96

Chains J and N: 57 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	70-72	3
β-strand	81-83	3	97
α-helix	84-101	18
α-helix	110-131	22
α-helix	134-141	8
α-helix	149-150	2
β-strand	152-154	3	97
β-strand	160	1	97
α-helix	172-188	17
α-helix	196-210	15
α-helix	211-214	4
β-strand	217	1	98
β-strand	233	1	98
α-helix	236-249	14
β-strand	253	1	99
α-helix	261-263	3
β-strand	264	1	99
α-helix	269-282	14
α-helix	296-300	5
α-helix	310-324	15
β-strand	325	1	100
β-strand	330-331	2	100
α-helix	350-351	2
α-helix	354-358	5
β-strand	364-365	2	100
α-helix	367-378	12
α-helix	382-395	14
β-strand	397-398	2	101
β-strand	404-405	2	101
β-strand	410-411	2	100
α-helix	412-413	2
α-helix	414-416	3
α-helix	417-422	6
β-strand	430-431	2	100
α-helix	442-455	14
α-helix	461-464	4
α-helix	473-475	3
β-strand	484	1	102
β-strand	487	1	102
β-strand	494-495	2	103
β-strand	498-501	4	104
α-helix	504-512	9
β-strand	518	1	104
β-strand	526-529	4	105
α-helix	531-538	8
β-strand	544	1	106
β-strand	549	1	106
β-strand	565-568	4	105
β-strand	571-575	5	105
α-helix	578-580	3
α-helix	586-589	4
α-helix	591-608	18
α-helix	614-615	2
β-strand	618-621	4	104
α-helix	623-626	4
α-helix	628-630	3
α-helix	631-643	13
β-strand	650-651	2	103
α-helix	656-659	4
β-strand	665-668	4	105
α-helix	716-720	5
α-helix	727-730	4
α-helix	737-750	14
β-strand	756	1	107
β-strand	761	1	107
α-helix	762-775	14
α-helix	779-788	10
α-helix	796-805	10
β-strand	809-813	5	108
β-strand	819-822	4	108
α-helix	828-833	6
α-helix	834-839	6
α-helix	845-863	19
α-helix	865-868	4
β-strand	873-875	3	108
α-helix	876-891	16
α-helix	895-898	4
α-helix	899-901	3
α-helix	904-914	11
β-strand	920	1	109
β-strand	922	1	109
α-helix	924-934	11
α-helix	941-950	10
β-strand	956-958	3	110
β-strand	961-963	3	110
α-helix	968-971	4
α-helix	977-986	10
α-helix	987-989	3
α-helix	993-1012	20
β-strand	1016	1	111
β-strand	1022-1023	2	110
α-helix	1024-1043	20
α-helix	1052-1056	5
α-helix	1065-1078	14
β-strand	1082	1	111

Chain M: 56 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	23-25	3
β-strand	42-43	2	34
α-helix	44-50	7
α-helix	52-62	11
α-helix	68-93	26
α-helix	96-104	9
α-helix	108-110	3
α-helix	112-113	2
β-strand	115-116	2	34
α-helix	127-129	3
α-helix	135-149	15
α-helix	159-171	13
β-strand	180	1	35
β-strand	196	1	35
α-helix	199-211	13
α-helix	232-245	14
β-strand	250	1	36
β-strand	253	1	36
β-strand	256	1	37
α-helix	257-259	3
α-helix	260-263	4
α-helix	273-286	14
β-strand	288-289	2	38
β-strand	292-294	3	38
β-strand	296	1	37
α-helix	325-326	2
β-strand	327-328	2	38
α-helix	330-337	8
β-strand	372-374	3	38
α-helix	377-379	3
α-helix	380-385	6
α-helix	392	1
β-strand	393-395	3	38
α-helix	401-414	14
α-helix	420-423	4
α-helix	428-430	3
α-helix	434-438	5
β-strand	440-446	7	39
α-helix	449-457	9
β-strand	463-464	2	39
β-strand	472-474	3	40
α-helix	476-483	8
β-strand	489	1	41
β-strand	494	1	41
α-helix	506-508	3
β-strand	511-513	3	40
β-strand	516-520	5	40
α-helix	523-526	4
α-helix	531-533	3
α-helix	536-553	18
β-strand	559	1	42
β-strand	561-566	6	39
α-helix	568-570	3
β-strand	571	1	43
β-strand	578	1	43
α-helix	580-590	11
β-strand	593-594	2	44
β-strand	597-598	2	44
β-strand	599-601	3	39
α-helix	606-608	3
β-strand	611	1	42
β-strand	614-615	2	40
α-helix	617-619	3
α-helix	767-770	4
α-helix	782-788	7
α-helix	789-793	5
β-strand	799	1	45
β-strand	805	1	45
α-helix	806-820	15
α-helix	823-832	10
α-helix	840-849	10
β-strand	853-855	3	46
β-strand	866-867	2	46
α-helix	873-883	11
α-helix	891-907	17
α-helix	909-912	4
β-strand	915	1	47
β-strand	917-919	3	46
α-helix	920-933	14
α-helix	939-945	7
α-helix	951-963	13
α-helix	1053-1063	11
β-strand	1066	1	47
α-helix	1071-1081	11
β-strand	1084-1087	4	48
β-strand	1090-1093	4	48
α-helix	1094-1096	3
α-helix	1107-1114	8
α-helix	1121-1140	20
β-strand	1149-1150	2	48
α-helix	1151-1169	19
α-helix	1177-1179	3
α-helix	1186-1190	5
β-strand	1194	1	49
α-helix	1199-1207	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform	A, E, I, M	protein	1223	Homo sapiens	P46020 (AlphaFold model)
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform	C, G, K, O	protein	387	Homo sapiens	Q16816 (AlphaFold model)
Phosphorylase b kinase regulatory subunit beta	B, F, J, N	protein	1093	Homo sapiens	Q93100 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>8JFL_1 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (chains A, E, I, M)
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ

Sequence of entity 2 (C, G, K, O), FASTA

>8JFL_2 Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (chains C, G, K, O)
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

Sequence of entity 3 (B, F, J, N), FASTA

>8JFL_3 Phosphorylase b kinase regulatory subunit beta (chains B, F, J, N)
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4
FAR	Farnesyl	C15 H26	8

Primary citation

Architecture and activation of human muscle phosphorylase kinase. Yang, X., Zhu, M., Lu, X. et al. Nat Commun (2024) 15:2719-2719. DOI 10.1038/s41467-024-47049-2 · PubMed

Other PDB entries of the same protein (UniProt P46020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XYA 2.7 Å, hPhK alpha-beta-gamma-delta subcomplex in inactive state
8JFK 2.9 Å, PhK holoenzyme in inactive state, muscle isoform
8XY7 2.9 Å, hPhK alpha-gamma subcomplex in active state
8XYB 3.1 Å, hPhK gamma-delta subcomplex in inactive state
8Z5P 3.41 Å, human phosphorylase kinase - inactive state
8Z5R 3.52 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - phosphorylation and Ca2+ bound…
8Z5M 3.66 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - inactive state
8Z5T 3.74 Å, human phosphorylase kinase - phosphorylation and Ca2+ bound state
8Z5Q 4.24 Å, human phosphorylase kinase - inactive state

Browse structure collections

About this viewer

MolViewer shows 8JFL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.