8Z5T: PDB entry 8Z5T

human phosphorylase kinase - phosphorylation and Ca2+ bound state. Determined by electron microscopy at 3.74 Å resolution. Released 23 Apr 2025.

Method: Electron microscopy
Resolution: 3.74 Å
Organism: Homo sapiens
Chains: 16
Atoms: 80,156
Mol. weight: 1325.13 kDa
Ligands: ATP
Released: 23 Apr 2025

Explore 8Z5T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z5T contains 520 α-helices and 366 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 52 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	6-21	16
α-helix	23-25	3
α-helix	32-34	3
β-strand	42-43	2	1
α-helix	44-63	20
α-helix	68-93	26
α-helix	96-103	8
α-helix	112-113	2
β-strand	115-116	2	1
α-helix	135-151	17
α-helix	159-172	14
α-helix	175-177	3
β-strand	180	1	2
β-strand	196	1	2
α-helix	199-211	13
β-strand	216	1	3
α-helix	219-221	3
α-helix	224-226	3
β-strand	227	1	3
α-helix	233-244	12
β-strand	256	1	4
α-helix	257-262	6
β-strand	264	1	5
β-strand	267	1	5
α-helix	273-287	15
β-strand	288-290	3	6
β-strand	292-294	3	6
β-strand	296	1	4
β-strand	327-328	2	6
α-helix	329-341	13
α-helix	346-358	13
β-strand	360-361	2	7
α-helix	363-365	3
β-strand	367-368	2	7
β-strand	372-374	3	6
α-helix	381-385	5
β-strand	393-395	3	6
α-helix	401-414	14
α-helix	420-423	4
α-helix	429-432	4
α-helix	434-435	2
β-strand	439-446	8	8
α-helix	449-457	9
β-strand	463-464	2	8
β-strand	471-474	4	9
α-helix	476-483	8
β-strand	488-489	2	10
β-strand	494-495	2	10
α-helix	498-499	2
α-helix	504-507	4
β-strand	510-513	4	9
β-strand	516-520	5	9
α-helix	523-525	3
α-helix	531-534	4
α-helix	536-552	17
β-strand	561-566	6	8
β-strand	571	1	11
β-strand	578	1	11
α-helix	580-590	11
β-strand	594	1	12
β-strand	597	1	12
β-strand	598-601	4	8
α-helix	604-608	5
β-strand	613-615	3	9
α-helix	617-619	3
α-helix	763-772	10
α-helix	776-789	14
α-helix	806-820	15
α-helix	826-832	7
α-helix	840-848	9
β-strand	853-855	3	13
β-strand	867	1	13
α-helix	873-884	12
α-helix	890-907	18
β-strand	917-919	3	13
α-helix	920-935	16
α-helix	939-948	10
α-helix	951-963	13
α-helix	1054-1063	10
α-helix	1071-1081	11
β-strand	1084-1086	3	14
β-strand	1092-1093	2	14
α-helix	1096-1099	4
α-helix	1105-1115	11
α-helix	1121-1140	20
β-strand	1148-1150	3	14
α-helix	1151-1169	19
α-helix	1186-1190	5
β-strand	1194	1	15
α-helix	1199-1213	15

Chain B: 54 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	45-57	13
α-helix	70-72	3
β-strand	81-83	3	16
α-helix	84-102	19
α-helix	111-130	20
α-helix	134-141	8
α-helix	145-147	3
β-strand	152-154	3	16
β-strand	160	1	16
α-helix	173-189	17
α-helix	196-210	15
β-strand	217	1	17
β-strand	233	1	17
α-helix	236-249	14
β-strand	253	1	18
β-strand	264	1	18
α-helix	269-279	11
α-helix	296-299	4
α-helix	312-324	13
β-strand	325	1	19
β-strand	330	1	19
α-helix	355-358	4
β-strand	364	1	20
β-strand	365	1	19
α-helix	367-379	13
α-helix	382-392	11
α-helix	393-395	3
β-strand	397-398	2	21
β-strand	404-405	2	21
β-strand	410-411	2	20
α-helix	414-416	3
α-helix	417-422	6
α-helix	428-429	2
β-strand	430-431	2	20
β-strand	436	1	22
β-strand	439	1	22
α-helix	442-455	14
α-helix	461-464	4
β-strand	479	1	23
β-strand	483	1	23
β-strand	494-501	8	24
α-helix	504-511	8
β-strand	518	1	24
α-helix	520-523	4
β-strand	527-529	3	25
α-helix	531-539	9
β-strand	566-568	3	25
β-strand	571-575	5	25
α-helix	578-580	3
α-helix	586-589	4
α-helix	591-607	17
α-helix	614-615	2
β-strand	616-621	6	24
α-helix	623-625	3
α-helix	628-630	3
α-helix	631-643	13
β-strand	645-646	2	24
β-strand	649-653	5	24
α-helix	656-660	5
β-strand	666-667	2	25
α-helix	670-673	4
α-helix	679-681	3
α-helix	687-691	5
α-helix	724-733	10
α-helix	737-750	14
β-strand	756-757	2	26
β-strand	760-761	2	26
α-helix	762-775	14
α-helix	779-789	11
α-helix	796-805	10
β-strand	809-812	4	27
β-strand	820-822	3	27
α-helix	828-836	9
α-helix	845-863	19
α-helix	865-868	4
β-strand	873-875	3	27
α-helix	876-891	16
α-helix	895-896	2
α-helix	903-914	12
α-helix	924-934	11
α-helix	941-951	11
β-strand	956-958	3	28
β-strand	961-963	3	28
α-helix	966-971	6
α-helix	977-987	11
α-helix	993-1012	20
β-strand	1016	1	29
β-strand	1022-1023	2	28
α-helix	1024-1043	20
α-helix	1045-1047	3
α-helix	1065-1079	15
β-strand	1082	1	29

Chain C: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	20-28	9	30
β-strand	32-39	8	30
β-strand	47-52	6	30
α-helix	61-80	20
β-strand	92-95	4	30
β-strand	99-104	6	30
β-strand	111	1	31
α-helix	112-119	8
α-helix	124-143	20
β-strand	146-147	2	32
α-helix	153-155	3
β-strand	156-158	3	31
β-strand	164-166	3	31
β-strand	173-174	2	32
α-helix	193-199	7
α-helix	211-225	15
α-helix	235-244	10
α-helix	259-268	10
α-helix	277-278	2
α-helix	279-283	5
α-helix	301-319	19
α-helix	322-324	3
α-helix	330-335	6
α-helix	341-354	14
α-helix	367-370	4
β-strand	371	1	15
α-helix	378-381	4

Chains D, H and P: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-20	14
α-helix	30-40	11
α-helix	46-56	11
α-helix	66-73	8
α-helix	80-93	14

Chain E: 51 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	6-21	16
α-helix	23-25	3
α-helix	32-34	3
β-strand	41-43	3	33
α-helix	44-63	20
α-helix	68-93	26
α-helix	96-102	7
α-helix	112-113	2
β-strand	115-117	3	33
α-helix	135-151	17
α-helix	159-172	14
α-helix	173-177	5
β-strand	180	1	34
β-strand	196	1	34
α-helix	199-211	13
β-strand	216	1	35
α-helix	219-221	3
α-helix	224-226	3
β-strand	227	1	35
α-helix	232-244	13
β-strand	256	1	36
α-helix	257-262	6
α-helix	273-287	15
β-strand	288-289	2	37
β-strand	292-294	3	37
β-strand	296	1	36
β-strand	327-328	2	37
α-helix	330-341	12
α-helix	346-358	13
β-strand	360-361	2	38
α-helix	363-365	3
β-strand	367-368	2	38
β-strand	372-374	3	37
α-helix	381-385	5
β-strand	393-395	3	37
α-helix	401-415	15
α-helix	420-423	4
α-helix	434-435	2
β-strand	440-446	7	39
α-helix	449-456	8
β-strand	463-464	2	39
β-strand	471-474	4	40
α-helix	476-483	8
β-strand	488-489	2	41
β-strand	494-495	2	41
α-helix	504-507	4
β-strand	510-513	4	40
β-strand	516-520	5	40
α-helix	523-525	3
α-helix	531-534	4
α-helix	536-552	17
β-strand	561-566	6	39
β-strand	571	1	42
β-strand	578	1	42
α-helix	580-590	11
β-strand	594	1	43
β-strand	597	1	43
β-strand	599-601	3	39
α-helix	604-608	5
β-strand	613-615	3	40
α-helix	617-619	3
α-helix	763-772	10
α-helix	776-789	14
α-helix	806-820	15
α-helix	826-833	8
α-helix	840-848	9
β-strand	853-855	3	44
β-strand	867	1	44
α-helix	873-884	12
α-helix	885-887	3
α-helix	889-907	19
β-strand	917-919	3	44
α-helix	920-935	16
α-helix	939-948	10
α-helix	951-963	13
α-helix	1054-1063	10
α-helix	1071-1081	11
β-strand	1084-1086	3	45
β-strand	1092-1093	2	45
α-helix	1096-1099	4
α-helix	1105-1115	11
α-helix	1121-1140	20
β-strand	1148-1150	3	45
α-helix	1151-1169	19
α-helix	1186-1190	5
β-strand	1194	1	46
α-helix	1199-1213	15

Chain F: 57 helices, 43 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	70-72	3
β-strand	81-82	2	47
α-helix	84-101	18
α-helix	111-130	20
α-helix	134-141	8
α-helix	145-147	3
β-strand	153-154	2	47
β-strand	160	1	47
α-helix	164-167	4
α-helix	173-188	16
α-helix	196-209	14
β-strand	217	1	48
β-strand	233	1	48
α-helix	236-248	13
β-strand	253	1	49
β-strand	264	1	49
α-helix	269-282	14
β-strand	293	1	50
α-helix	296-299	4
α-helix	311-324	14
β-strand	325	1	51
β-strand	330	1	51
β-strand	333	1	50
α-helix	355-358	4
β-strand	364	1	52
β-strand	365	1	51
α-helix	367-379	13
α-helix	382-392	11
α-helix	393-395	3
β-strand	397-398	2	53
β-strand	404-405	2	53
β-strand	410-411	2	52
α-helix	414-416	3
α-helix	417-422	6
β-strand	430-431	2	52
β-strand	436	1	54
β-strand	439	1	54
α-helix	442-455	14
α-helix	473-475	3
β-strand	479	1	55
β-strand	483	1	55
α-helix	493-494	2
β-strand	495-501	7	56
α-helix	504-511	8
β-strand	518	1	56
α-helix	520-523	4
β-strand	526-529	4	57
α-helix	531-539	9
β-strand	543	1	58
β-strand	550	1	58
α-helix	561-563	3
β-strand	566-568	3	57
β-strand	571-575	5	57
α-helix	578-580	3
α-helix	586-589	4
α-helix	591-607	17
β-strand	616-621	6	56
α-helix	623-625	3
α-helix	628-630	3
α-helix	631-643	13
β-strand	645-646	2	59
β-strand	649-650	2	59
β-strand	651-653	3	56
α-helix	656-660	5
β-strand	666-667	2	57
α-helix	670-673	4
α-helix	679-681	3
α-helix	683-685	3
α-helix	687-691	5
α-helix	724-733	10
α-helix	737-750	14
β-strand	756-757	2	60
β-strand	760-761	2	60
α-helix	762-775	14
α-helix	779-789	11
α-helix	796-805	10
β-strand	809-813	5	61
β-strand	819-822	4	61
α-helix	828-836	9
α-helix	845-863	19
α-helix	865-868	4
β-strand	873-875	3	61
α-helix	876-891	16
α-helix	895-896	2
α-helix	903-914	12
α-helix	924-934	11
α-helix	941-951	11
β-strand	956-958	3	62
β-strand	961-963	3	62
α-helix	966-971	6
α-helix	977-987	11
α-helix	993-1012	20
β-strand	1016	1	63
β-strand	1022-1023	2	62
α-helix	1024-1043	20
α-helix	1045-1047	3
α-helix	1065-1079	15
β-strand	1082	1	63
α-helix	1083-1085	3

Chain G: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	20	1	64
β-strand	25-28	4	65
β-strand	32-36	5	65
β-strand	39	1	64
β-strand	47-52	6	65
α-helix	61-80	20
β-strand	92-95	4	65
β-strand	99-104	6	65
β-strand	111	1	66
α-helix	112-119	8
α-helix	124-143	20
β-strand	146-147	2	67
β-strand	156-158	3	66
β-strand	164-166	3	66
β-strand	173-174	2	67
α-helix	193-198	6
α-helix	210-225	16
α-helix	235-244	10
α-helix	259-268	10
α-helix	277-278	2
α-helix	279-283	5
α-helix	301-319	19
α-helix	330-335	6
α-helix	341-354	14
α-helix	367-370	4
β-strand	371	1	46
α-helix	378-380	3

Chain I: 53 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	6-21	16
α-helix	23-25	3
α-helix	32-34	3
β-strand	41-43	3	68
α-helix	44-63	20
α-helix	68-93	26
α-helix	96-102	7
α-helix	112-113	2
β-strand	115-117	3	68
β-strand	123	1	68
α-helix	135-151	17
α-helix	159-172	14
α-helix	175-177	3
β-strand	180	1	69
β-strand	196	1	69
β-strand	198	1	70
α-helix	199-211	13
β-strand	216	1	71
α-helix	224-226	3
β-strand	227	1	71
α-helix	232-244	13
β-strand	250	1	70
β-strand	256	1	72
α-helix	257-261	5
β-strand	264	1	73
β-strand	267	1	73
α-helix	273-287	15
β-strand	288-290	3	74
β-strand	292-293	2	74
β-strand	296	1	72
β-strand	327	1	75
β-strand	328	1	74
α-helix	329-341	13
α-helix	346-358	13
β-strand	360-361	2	76
α-helix	363-365	3
β-strand	367-368	2	76
β-strand	372-374	3	75
α-helix	381-385	5
β-strand	393-395	3	75
α-helix	401-415	15
α-helix	420-423	4
α-helix	429-432	4
α-helix	434-435	2
β-strand	439-440	2	77
β-strand	442-446	5	78
α-helix	449-457	9
β-strand	463-464	2	78
β-strand	471-474	4	79
α-helix	476-483	8
β-strand	488-489	2	80
β-strand	494-495	2	80
α-helix	498-499	2
α-helix	504-507	4
β-strand	510-513	4	79
β-strand	516-520	5	79
α-helix	523-525	3
α-helix	531-534	4
α-helix	536-552	17
β-strand	562-566	5	78
α-helix	568-570	3
β-strand	571	1	81
β-strand	578	1	81
α-helix	580-591	12
β-strand	593-594	2	77
β-strand	597-599	3	77
α-helix	604-607	4
β-strand	613-615	3	79
α-helix	617-619	3
α-helix	763-772	10
α-helix	776-789	14
α-helix	806-820	15
α-helix	826-833	8
α-helix	840-848	9
β-strand	853-855	3	82
β-strand	867	1	82
α-helix	873-884	12
α-helix	885-887	3
α-helix	890-907	18
β-strand	915	1	83
β-strand	917-919	3	82
α-helix	920-935	16
α-helix	939-948	10
α-helix	951-963	13
α-helix	1054-1063	10
β-strand	1066	1	83
α-helix	1071-1081	11
β-strand	1084-1086	3	84
β-strand	1092-1093	2	84
α-helix	1094-1097	4
α-helix	1105-1115	11
α-helix	1121-1140	20
β-strand	1148-1150	3	84
α-helix	1151-1169	19
α-helix	1186-1190	5
β-strand	1194	1	85
α-helix	1199-1213	15

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform	A, E, I, M	protein	1223	Homo sapiens	P46020 (AlphaFold model)
Phosphorylase b kinase regulatory subunit beta	B, F, J, N	protein	1093	Homo sapiens	Q93100 (AlphaFold model)
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform	C, G, K, O	protein	387	Homo sapiens	Q16816 (AlphaFold model)
Calmodulin-3	D, H, L, P	protein	168	Homo sapiens	P0DP25 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>8Z5T_1 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (chains A, E, I, M)
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ

Sequence of entity 2 (B, F, J, N), FASTA

>8Z5T_2 Phosphorylase b kinase regulatory subunit beta (chains B, F, J, N)
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS

Sequence of entity 3 (C, G, K, O), FASTA

>8Z5T_3 Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (chains C, G, K, O)
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

Sequence of entity 4 (D, H, L, P), FASTA

>8Z5T_4 Calmodulin-3 (chains D, H, L, P)
DYKDDDDKSGPDEVDASGRMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG
QNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYI
SAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	8

Primary citation

Molecular basis for the regulation of human phosphorylase kinase by phosphorylation and Ca 2. Ma, R., Du, B., Shi, C. et al. Nat Commun (2025) 16:3020-3020. DOI 10.1038/s41467-025-58363-8 · PubMed

Other PDB entries of the same protein (UniProt P46020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XYA 2.7 Å, hPhK alpha-beta-gamma-delta subcomplex in inactive state
8JFK 2.9 Å, PhK holoenzyme in inactive state, muscle isoform
8JFL 2.9 Å, PhK holoenzyme in active state, muscle isoform
8XY7 2.9 Å, hPhK alpha-gamma subcomplex in active state
8XYB 3.1 Å, hPhK gamma-delta subcomplex in inactive state
8Z5P 3.41 Å, human phosphorylase kinase - inactive state
8Z5R 3.52 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - phosphorylation and Ca2+ bound…
8Z5M 3.66 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - inactive state
8Z5Q 4.24 Å, human phosphorylase kinase - inactive state

Browse structure collections

About this viewer

MolViewer shows 8Z5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.