8XY7: HPhK alpha-gamma subcomplex in active state

hPhK alpha-gamma subcomplex in active state. Determined by electron microscopy at 2.9 Å resolution. Released 3 Apr 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,090
Mol. weight: 182.76 kDa
Ligands: FAR
Released: 3 Apr 2024

Explore 8XY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XY7 contains 59 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	23-25	3
β-strand	42-43	2	1
α-helix	44-50	7
α-helix	52-62	11
α-helix	68-93	26
α-helix	96-104	9
α-helix	108-110	3
α-helix	112-113	2
β-strand	115-116	2	1
α-helix	127-129	3
α-helix	135-149	15
α-helix	159-171	13
β-strand	180	1	2
β-strand	196	1	2
α-helix	199-211	13
α-helix	232-245	14
β-strand	250	1	3
β-strand	253	1	3
β-strand	256	1	4
α-helix	257-259	3
α-helix	260-263	4
α-helix	273-286	14
β-strand	288-289	2	5
β-strand	292-294	3	5
β-strand	296	1	4
α-helix	325-326	2
β-strand	327-328	2	5
α-helix	330-337	8
β-strand	372-374	3	5
α-helix	377-379	3
α-helix	380-385	6
α-helix	392	1
β-strand	393-395	3	5
α-helix	401-414	14
α-helix	420-423	4
α-helix	428-430	3
α-helix	434-438	5
β-strand	440-446	7	6
α-helix	449-457	9
β-strand	463-464	2	6
β-strand	472-474	3	7
α-helix	476-483	8
β-strand	489	1	8
β-strand	494	1	8
α-helix	506-508	3
β-strand	511-513	3	7
β-strand	516-520	5	7
α-helix	523-526	4
α-helix	531-533	3
α-helix	536-553	18
β-strand	559	1	9
β-strand	561-566	6	6
α-helix	568-570	3
β-strand	571	1	10
β-strand	578	1	10
α-helix	580-590	11
β-strand	593-594	2	11
β-strand	597-598	2	11
β-strand	599-601	3	6
α-helix	606-608	3
β-strand	611	1	9
β-strand	614-615	2	7
α-helix	617-619	3
α-helix	767-770	4
α-helix	782-788	7
α-helix	789-793	5
β-strand	799	1	12
β-strand	805	1	12
α-helix	806-820	15
α-helix	823-832	10
α-helix	840-849	10
β-strand	853-855	3	13
β-strand	866-867	2	13
α-helix	873-883	11
α-helix	891-907	17
α-helix	909-912	4
β-strand	915	1	14
β-strand	917-919	3	13
α-helix	920-933	14
α-helix	939-945	7
α-helix	951-963	13
α-helix	1053-1063	11
β-strand	1066	1	14
α-helix	1071-1081	11
β-strand	1084-1087	4	15
β-strand	1090-1093	4	15
α-helix	1094-1096	3
α-helix	1107-1114	8
α-helix	1121-1140	20
β-strand	1149-1150	2	15
α-helix	1151-1169	19
α-helix	1186-1190	5
β-strand	1194	1	16
α-helix	1199-1207	9

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	330-335	6
α-helix	341-355	15
α-helix	368-370	3
β-strand	371	1	16
α-helix	376-379	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform	A	protein	1223	Homo sapiens	P46020 (AlphaFold model)
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform	C	protein	387	Homo sapiens	Q16816 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8XY7_1 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (chains A)
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ

Sequence of entity 2 (C), FASTA

>8XY7_2 Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (chains C)
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

Ligands and cofactors

ID	Name	Formula	Copies
FAR	Farnesyl	C15 H26	1

Primary citation

Architecture and activation of human muscle phosphorylase kinase. Yang, X., Zhu, M., Lu, X. et al. Nat Commun (2024) 15:2719-2719. DOI 10.1038/s41467-024-47049-2 · PubMed

Other PDB entries of the same protein (UniProt P46020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XYA 2.7 Å, hPhK alpha-beta-gamma-delta subcomplex in inactive state
8JFK 2.9 Å, PhK holoenzyme in inactive state, muscle isoform
8JFL 2.9 Å, PhK holoenzyme in active state, muscle isoform
8XYB 3.1 Å, hPhK gamma-delta subcomplex in inactive state
8Z5P 3.41 Å, human phosphorylase kinase - inactive state
8Z5R 3.52 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - phosphorylation and Ca2+ bound…
8Z5M 3.66 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - inactive state
8Z5T 3.74 Å, human phosphorylase kinase - phosphorylation and Ca2+ bound state
8Z5Q 4.24 Å, human phosphorylase kinase - inactive state

Browse structure collections

About this viewer

MolViewer shows 8XY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.