8Z5Q: Human phosphorylase kinase - inactive state

human phosphorylase kinase - inactive state. Determined by electron microscopy at 4.24 Å resolution. Released 23 Apr 2025.

Method: Electron microscopy
Resolution: 4.24 Å
Organism: Homo sapiens
Chains: 16
Atoms: 80,239
Mol. weight: 1306.03 kDa
Released: 23 Apr 2025

Explore 8Z5Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z5Q contains 527 α-helices and 326 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 53 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	6-21	16
α-helix	23-25	3
β-strand	42-43	2	1
α-helix	44-49	6
α-helix	52-63	12
α-helix	68-93	26
α-helix	96-103	8
β-strand	115-116	2	1
α-helix	135-151	17
α-helix	159-172	14
α-helix	175-177	3
β-strand	180	1	2
β-strand	196	1	2
α-helix	199-211	13
β-strand	216	1	3
α-helix	219-221	3
β-strand	227	1	3
α-helix	233-244	12
α-helix	259-262	4
α-helix	273-287	15
β-strand	288	1	4
β-strand	293	1	4
β-strand	328	1	4
α-helix	330-341	12
α-helix	346-356	11
β-strand	372-374	3	5
α-helix	375-376	2
α-helix	381-385	5
β-strand	393-395	3	5
α-helix	401-414	14
α-helix	420-423	4
α-helix	428-430	3
β-strand	440-446	7	6
α-helix	449-457	9
β-strand	463-464	2	6
β-strand	471-474	4	7
α-helix	476-483	8
β-strand	488-489	2	8
β-strand	494-495	2	8
α-helix	498-499	2
α-helix	501-503	3
α-helix	504-508	5
β-strand	510-512	3	7
β-strand	517-520	4	7
α-helix	523-525	3
α-helix	532-534	3
α-helix	536-552	17
β-strand	562-566	5	6
α-helix	567	1
α-helix	568-570	3
β-strand	571	1	9
β-strand	578	1	9
α-helix	580-589	10
α-helix	590-592	3
β-strand	594	1	10
β-strand	597	1	10
β-strand	599-601	3	6
α-helix	604-607	4
β-strand	613-615	3	7
α-helix	763-772	10
α-helix	776-789	14
β-strand	795	1	11
β-strand	805	1	11
α-helix	806-820	15
α-helix	826-833	8
α-helix	840-848	9
β-strand	853	1	12
β-strand	854	1	13
β-strand	867	1	13
α-helix	873-884	12
α-helix	885-887	3
α-helix	889-907	19
β-strand	917	1	12
α-helix	920-935	16
α-helix	939-948	10
α-helix	951-963	13
α-helix	1054-1064	11
α-helix	1071-1079	9
β-strand	1084	1	14
β-strand	1085-1086	2	15
β-strand	1087	1	16
β-strand	1090	1	16
β-strand	1093	1	14
α-helix	1096-1099	4
α-helix	1105-1115	11
α-helix	1121-1140	20
β-strand	1149-1150	2	15
α-helix	1151-1169	19
α-helix	1186-1190	5
α-helix	1199-1213	15

Chain B: 53 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	61-63	3
β-strand	81-82	2	17
α-helix	85-101	17
α-helix	110-131	22
α-helix	134-141	8
α-helix	149-150	2
β-strand	153-154	2	17
β-strand	159	1	17
α-helix	173-188	16
α-helix	197-209	13
β-strand	217	1	18
β-strand	233	1	18
α-helix	236-249	14
α-helix	269-282	14
α-helix	296-299	4
α-helix	311-324	14
β-strand	330	1	19
α-helix	350-351	2
α-helix	354-357	4
β-strand	364	1	20
β-strand	365	1	19
α-helix	367-378	12
α-helix	382-395	14
β-strand	397-398	2	21
β-strand	404-405	2	21
β-strand	410-411	2	20
α-helix	414-416	3
α-helix	419-422	4
β-strand	430-431	2	20
α-helix	433-435	3
α-helix	442-455	14
α-helix	461-464	4
β-strand	495-500	6	22
α-helix	504-512	9
β-strand	518	1	22
α-helix	520-522	3
β-strand	527-528	2	23
α-helix	531-540	10
α-helix	559-562	4
β-strand	566-568	3	23
β-strand	571-574	4	23
α-helix	578-580	3
α-helix	587-589	3
α-helix	591-607	17
β-strand	616-620	5	22
α-helix	623-626	4
α-helix	628-631	4
α-helix	632-643	12
β-strand	645	1	24
β-strand	650	1	24
β-strand	651-653	3	22
α-helix	656-660	5
β-strand	666-667	2	23
α-helix	670-673	4
α-helix	716-720	5
α-helix	724-733	10
α-helix	737-750	14
β-strand	756-757	2	25
β-strand	760-761	2	25
α-helix	762-776	15
α-helix	779-789	11
α-helix	796-806	11
β-strand	809-813	5	26
β-strand	819-821	3	26
α-helix	828-841	14
α-helix	846-863	18
α-helix	865-868	4
β-strand	871	1	27
β-strand	873-875	3	26
α-helix	876-891	16
α-helix	895-898	4
α-helix	904-914	11
α-helix	924-933	10
β-strand	936	1	27
α-helix	941-950	10
β-strand	955-958	4	28
β-strand	961-964	4	28
α-helix	965-971	7
α-helix	977-987	11
α-helix	993-1011	19
β-strand	1022-1023	2	28
α-helix	1024-1042	19
α-helix	1052-1056	5
α-helix	1065-1078	14

Chain C: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	20-28	9	29
β-strand	32-39	8	29
β-strand	45-52	8	29
α-helix	61-81	21
β-strand	87	1	30
β-strand	90-95	6	29
β-strand	99-104	6	29
β-strand	111	1	31
α-helix	112-119	8
α-helix	124-143	20
β-strand	146-147	2	32
α-helix	153-155	3
β-strand	156	1	30
β-strand	157	1	31
β-strand	166	1	30
β-strand	173-174	2	32
β-strand	181	1	33
α-helix	188-190	3
α-helix	193-200	8
β-strand	207	1	33
α-helix	210-224	15
α-helix	235-244	10
α-helix	259-268	10
α-helix	277-278	2
α-helix	279-283	5
α-helix	286-288	3
α-helix	301-323	23
α-helix	330-335	6
α-helix	341-354	14
α-helix	367-369	3
α-helix	378-381	4

Chain D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-20	14
α-helix	30-40	11
α-helix	46-56	11
α-helix	66-73	8
α-helix	80-93	14
α-helix	103-113	11
α-helix	119-129	11
α-helix	139-146	8

Chain E: 52 helices, 35 β-strands

Element	Residues	Length	Sheet
α-helix	6-21	16
α-helix	23-25	3
β-strand	42-43	2	34
α-helix	44-49	6
α-helix	52-64	13
α-helix	68-93	26
α-helix	96-103	8
β-strand	115-116	2	34
α-helix	135-151	17
α-helix	159-172	14
α-helix	175-177	3
β-strand	180	1	35
β-strand	196	1	35
α-helix	199-211	13
β-strand	216	1	36
α-helix	219-221	3
β-strand	227	1	36
α-helix	233-244	12
α-helix	259-262	4
α-helix	273-287	15
β-strand	288	1	37
β-strand	293	1	37
α-helix	329-341	13
α-helix	346-357	12
β-strand	360-361	2	38
α-helix	363-365	3
β-strand	367-368	2	38
β-strand	373-374	2	39
α-helix	375-376	2
α-helix	381-385	5
β-strand	393-394	2	39
α-helix	401-415	15
α-helix	420-423	4
β-strand	440-446	7	40
α-helix	449-457	9
β-strand	463-464	2	40
β-strand	471-474	4	41
α-helix	476-483	8
β-strand	488-489	2	42
β-strand	494-495	2	42
α-helix	498-499	2
α-helix	504-507	4
β-strand	510-512	3	41
β-strand	517-520	4	41
α-helix	523-525	3
α-helix	532-534	3
α-helix	536-552	17
β-strand	562-566	5	40
α-helix	567	1
α-helix	568-570	3
β-strand	571	1	43
β-strand	578	1	43
α-helix	580-589	10
α-helix	590-592	3
β-strand	594	1	44
β-strand	597	1	44
β-strand	599-601	3	40
α-helix	604-609	6
β-strand	613-615	3	41
α-helix	763-772	10
α-helix	776-789	14
β-strand	795	1	45
β-strand	805	1	45
α-helix	806-820	15
α-helix	826-833	8
α-helix	840-848	9
β-strand	853	1	46
β-strand	854	1	47
β-strand	867	1	47
α-helix	873-884	12
α-helix	885-887	3
α-helix	889-907	19
β-strand	917	1	46
α-helix	920-935	16
α-helix	939-947	9
α-helix	951-963	13
α-helix	1054-1064	11
α-helix	1071-1079	9
β-strand	1084-1087	4	48
β-strand	1090-1093	4	48
α-helix	1094-1097	4
α-helix	1105-1115	11
α-helix	1121-1140	20
β-strand	1148-1150	3	48
α-helix	1151-1169	19
α-helix	1186-1190	5
α-helix	1199-1213	15

Chain F: 53 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	45-59	15
α-helix	61-63	3
α-helix	85-101	17
α-helix	110-131	22
α-helix	134-141	8
α-helix	149-150	2
α-helix	173-188	16
α-helix	196-209	14
β-strand	217	1	49
β-strand	233	1	49
α-helix	236-249	14
α-helix	269-282	14
β-strand	293	1	50
α-helix	296-299	4
α-helix	311-324	14
β-strand	325-326	2	51
β-strand	329-330	2	51
β-strand	333	1	50
α-helix	350-351	2
α-helix	354-358	5
β-strand	364	1	52
β-strand	365	1	51
α-helix	367-378	12
α-helix	382-395	14
β-strand	397-398	2	53
β-strand	404-405	2	53
β-strand	410-411	2	52
α-helix	414-416	3
α-helix	419-422	4
β-strand	430-431	2	52
α-helix	433-435	3
α-helix	442-455	14
α-helix	461-464	4
β-strand	495-500	6	54
α-helix	504-512	9
α-helix	520-522	3
β-strand	527-528	2	55
α-helix	531-540	10
α-helix	556-558	3
α-helix	559-562	4
β-strand	566-568	3	55
β-strand	571-574	4	55
α-helix	587-589	3
α-helix	591-607	17
β-strand	616-620	5	54
α-helix	628-630	3
α-helix	631-643	13
β-strand	645	1	56
β-strand	650	1	56
β-strand	651-654	4	54
α-helix	656-660	5
β-strand	666-668	3	55
α-helix	670-673	4
α-helix	716-720	5
α-helix	724-733	10
α-helix	737-750	14
β-strand	756-757	2	57
β-strand	760-761	2	57
α-helix	762-776	15
α-helix	779-789	11
α-helix	796-806	11
β-strand	809-813	5	58
β-strand	819-822	4	58
α-helix	828-841	14
α-helix	846-863	18
α-helix	865-868	4
β-strand	873-875	3	58
α-helix	876-891	16
α-helix	895-898	4
α-helix	899-901	3
α-helix	904-914	11
α-helix	924-933	10
α-helix	941-950	10
β-strand	955-958	4	59
β-strand	961-964	4	59
α-helix	965-971	7
α-helix	977-987	11
α-helix	993-1012	20
β-strand	1022-1023	2	59
α-helix	1024-1042	19
α-helix	1052-1056	5
α-helix	1065-1078	14

Chain G: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	20-28	9	60
β-strand	32-39	8	60
β-strand	44-52	9	60
α-helix	55-57	3
α-helix	61-81	21
β-strand	87	1	61
β-strand	92-95	4	60
β-strand	99-104	6	60
β-strand	111	1	61
α-helix	112-119	8
α-helix	124-143	20
β-strand	146-147	2	62
α-helix	153-155	3
β-strand	156-158	3	61
β-strand	164-166	3	61
β-strand	173-174	2	62
β-strand	181	1	63
α-helix	188-190	3
α-helix	193-200	8
β-strand	207	1	63
α-helix	210-224	15
α-helix	235-244	10
α-helix	259-268	10
α-helix	279-283	5
α-helix	286-288	3
α-helix	301-323	23
α-helix	330-335	6
α-helix	341-354	14
α-helix	367-369	3
α-helix	378-381	4

Chains H and P: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-20	14
α-helix	30-40	11
α-helix	46-56	11
α-helix	66-73	8
α-helix	80-93	14
α-helix	103-113	11
α-helix	119-129	11
α-helix	139-145	7

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform	A, E, I, M	protein	1223	Homo sapiens	P46020 (AlphaFold model)
Phosphorylase b kinase regulatory subunit beta	B, F, J, N	protein	1093	Homo sapiens	Q93100 (AlphaFold model)
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform	C, G, K, O	protein	387	Homo sapiens	Q16816 (AlphaFold model)
Calmodulin-3	D, H, L, P	protein	168	Homo sapiens	P0DP25 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>8Z5Q_1 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (chains A, E, I, M)
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ

Sequence of entity 2 (B, F, J, N), FASTA

>8Z5Q_2 Phosphorylase b kinase regulatory subunit beta (chains B, F, J, N)
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS

Sequence of entity 3 (C, G, K, O), FASTA

>8Z5Q_3 Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (chains C, G, K, O)
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

Sequence of entity 4 (D, H, L, P), FASTA

>8Z5Q_4 Calmodulin-3 (chains D, H, L, P)
DYKDDDDKSGPDEVDASGRMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG
QNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYI
SAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Primary citation

Molecular basis for the regulation of human phosphorylase kinase by phosphorylation and Ca 2. Ma, R., Du, B., Shi, C. et al. Nat Commun (2025) 16:3020-3020. DOI 10.1038/s41467-025-58363-8 · PubMed

Other PDB entries of the same protein (UniProt P46020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XYA 2.7 Å, hPhK alpha-beta-gamma-delta subcomplex in inactive state
8JFK 2.9 Å, PhK holoenzyme in inactive state, muscle isoform
8JFL 2.9 Å, PhK holoenzyme in active state, muscle isoform
8XY7 2.9 Å, hPhK alpha-gamma subcomplex in active state
8XYB 3.1 Å, hPhK gamma-delta subcomplex in inactive state
8Z5P 3.41 Å, human phosphorylase kinase - inactive state
8Z5R 3.52 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - phosphorylation and Ca2+ bound…
8Z5M 3.66 Å, human phosphorylase kinase alpha/gamma/delta subcomplex - inactive state
8Z5T 3.74 Å, human phosphorylase kinase - phosphorylation and Ca2+ bound state

Browse structure collections

About this viewer

MolViewer shows 8Z5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.