8JH3: DNA-directed RNA polymerase subunit
RNA polymerase II elongation complex containing 40 bp upstream DNA loop, stalled at SHL(-1) of the nucleosome. Determined by electron microscopy at 3.7 Å resolution. Released 29 Nov 2023.
- Method
- Electron microscopy
- Resolution
- 3.7 Å
- Organisms
- Komagataella phaffii, synthetic construct, Homo sapiens
- Chains
- 23
- Atoms
- 43,416
- Mol. weight
- 747.09 kDa
- Ligands
- MG, ZN
- Released
- 29 Nov 2023
Explore 8JH3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8JH3 contains 230 α-helices and 251 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-42 | 3 | |
| α-helix | 46-55 | 10 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 75 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 76 |
| α-helix | 121-131 | 11 | |
Chain A: 84 helices, 67 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10 | 1 | |
| β-strand | 11 | 1 | 1 |
| β-strand | 16-18 | 3 | 2 |
| β-strand | 21 | 1 | 3 |
| α-helix | 22-23 | 2 | |
| α-helix | 24-30 | 7 | |
| β-strand | 34 | 1 | 4 |
| α-helix | 48-49 | 2 | |
| α-helix | 56-58 | 3 | |
| β-strand | 82-91 | 10 | 4 |
| α-helix | 93-95 | 3 | |
| α-helix | 96-105 | 10 | |
| β-strand | 106 | 1 | 5 |
| β-strand | 113 | 1 | 5 |
| α-helix | 120-125 | 6 | |
| α-helix | 131-142 | 12 | |
| β-strand | 147 | 1 | 6 |
| α-helix | 170 | 1 | |
| β-strand | 171 | 1 | 6 |
| α-helix | 172 | 1 | |
| β-strand | 173-178 | 6 | 7 |
| β-strand | 181-186 | 6 | 7 |
| β-strand | 199-203 | 5 | 7 |
| α-helix | 205-213 | 9 | |
| α-helix | 217-223 | 7 | |
| α-helix | 232-235 | 4 | |
| β-strand | 236-242 | 7 | 4 |
| α-helix | 245-247 | 3 | |
| β-strand | 251-252 | 2 | 8 |
| β-strand | 258-259 | 2 | 8 |
| α-helix | 262-277 | 16 | |
| α-helix | 290-305 | 16 | |
| α-helix | 313-315 | 3 | |
| β-strand | 316 | 1 | 9 |
| α-helix | 321 | 1 | |
| β-strand | 322 | 1 | 9 |
| α-helix | 323 | 1 | |
| α-helix | 326-330 | 5 | |
| α-helix | 336 | 1 | |
| α-helix | 337-341 | 5 | |
| β-strand | 344-346 | 3 | 10 |
| β-strand | 349-356 | 8 | 11 |
| β-strand | 364-368 | 5 | 11 |
| α-helix | 369-374 | 6 | |
| β-strand | 376-380 | 5 | 12 |
| α-helix | 386-395 | 10 | |
| β-strand | 403-407 | 5 | 12 |
| β-strand | 413-415 | 3 | 12 |
| α-helix | 422-424 | 3 | |
| α-helix | 427-428 | 2 | |
| β-strand | 432-436 | 5 | 12 |
| β-strand | 442-446 | 5 | 11 |
| α-helix | 453-455 | 3 | |
| β-strand | 456-464 | 9 | 11 |
| β-strand | 469-471 | 3 | 11 |
| α-helix | 473-475 | 3 | |
| α-helix | 476-479 | 4 | |
| β-strand | 487-491 | 5 | 11 |
| α-helix | 496-501 | 6 | |
| α-helix | 502-506 | 5 | |
| β-strand | 507 | 1 | 11 |
| α-helix | 508-511 | 4 | |
| β-strand | 513 | 1 | 13 |
| β-strand | 520 | 1 | 13 |
| α-helix | 527-535 | 9 | |
| β-strand | 541-542 | 2 | 14 |
| α-helix | 544-553 | 10 | |
| α-helix | 561-564 | 4 | |
| β-strand | 566-568 | 3 | 15 |
| β-strand | 572 | 1 | 15 |
| β-strand | 573-574 | 2 | 14 |
| α-helix | 575-582 | 8 | |
| α-helix | 584 | 1 | |
| β-strand | 589-591 | 3 | 16 |
| β-strand | 606-609 | 4 | 16 |
| β-strand | 612-615 | 4 | 16 |
| α-helix | 620-623 | 4 | |
| α-helix | 630-638 | 9 | |
| α-helix | 640-661 | 22 | |
| α-helix | 667-670 | 4 | |
| α-helix | 674-699 | 26 | |
| α-helix | 711-737 | 27 | |
| α-helix | 743-750 | 8 | |
| α-helix | 756-763 | 8 | |
| β-strand | 767-768 | 2 | 17 |
| β-strand | 771 | 1 | 18 |
| β-strand | 774 | 1 | 18 |
| β-strand | 780 | 1 | 19 |
| β-strand | 783 | 1 | 19 |
| β-strand | 800-801 | 2 | 17 |
| α-helix | 811-846 | 36 | |
| β-strand | 850-851 | 2 | 20 |
| β-strand | 857-858 | 2 | 20 |
| β-strand | 864-866 | 3 | 20 |
| α-helix | 869-871 | 3 | |
| β-strand | 874 | 1 | 21 |
| β-strand | 879-883 | 5 | 22 |
| α-helix | 891-898 | 8 | |
| α-helix | 911-913 | 3 | |
| β-strand | 914 | 1 | 23 |
| α-helix | 917-920 | 4 | |
| α-helix | 927-943 | 17 | |
| α-helix | 944-948 | 5 | |
| β-strand | 955-959 | 5 | 22 |
| α-helix | 963-973 | 11 | |
| α-helix | 979-980 | 2 | |
| β-strand | 981 | 1 | 23 |
| α-helix | 985-996 | 12 | |
| α-helix | 1007-1016 | 10 | |
| α-helix | 1018-1027 | 10 | |
| α-helix | 1030-1031 | 2 | |
| α-helix | 1032-1036 | 5 | |
| α-helix | 1041-1057 | 17 | |
| β-strand | 1059 | 1 | 21 |
| α-helix | 1060-1061 | 2 | |
| α-helix | 1066-1078 | 13 | |
| α-helix | 1099-1107 | 9 | |
| β-strand | 1117-1120 | 4 | 24 |
| α-helix | 1121 | 1 | |
| β-strand | 1122 | 1 | 25 |
| α-helix | 1123 | 1 | |
| α-helix | 1124-1128 | 5 | |
| α-helix | 1130-1140 | 11 | |
| β-strand | 1143-1144 | 2 | 26 |
| α-helix | 1145-1148 | 4 | |
| β-strand | 1149-1156 | 8 | 27 |
| α-helix | 1169-1174 | 6 | |
| β-strand | 1193-1199 | 7 | 27 |
| α-helix | 1201-1206 | 6 | |
| α-helix | 1211-1221 | 11 | |
| β-strand | 1227-1230 | 4 | 27 |
| β-strand | 1239-1243 | 5 | 27 |
| α-helix | 1262-1273 | 12 | |
| β-strand | 1275-1277 | 3 | 26 |
| β-strand | 1284-1295 | 12 | 24 |
| β-strand | 1301-1312 | 12 | 24 |
| α-helix | 1316-1321 | 6 | |
| β-strand | 1325 | 1 | 25 |
| β-strand | 1331-1332 | 2 | 24 |
| α-helix | 1335-1342 | 8 | |
| α-helix | 1344-1360 | 17 | |
| α-helix | 1368-1378 | 11 | |
| α-helix | 1389-1392 | 4 | |
| α-helix | 1399-1405 | 7 | |
| α-helix | 1408-1418 | 11 | |
| β-strand | 1421-1422 | 2 | 2 |
| α-helix | 1427-1432 | 6 | |
| α-helix | 1440-1442 | 3 | |
| β-strand | 1444-1448 | 5 | 28 |
| α-helix | 1453-1455 | 3 | |
| α-helix | 1458-1460 | 3 | |
Chains b and f: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 76 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 75 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 77 |
Chain B: 54 helices, 79 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-28 | 15 | |
| α-helix | 32-40 | 9 | |
| α-helix | 41-45 | 5 | |
| α-helix | 46-50 | 5 | |
| β-strand | 55-60 | 6 | 29 |
| β-strand | 72-84 | 13 | 29 |
| β-strand | 88-90 | 3 | 30 |
| β-strand | 96-98 | 3 | 30 |
| α-helix | 101-106 | 6 | |
| β-strand | 112-126 | 15 | 29 |
| β-strand | 155-162 | 8 | 29 |
| α-helix | 177-182 | 6 | |
| β-strand | 194-196 | 3 | 31 |
| β-strand | 199-203 | 5 | 31 |
| α-helix | 204 | 1 | |
| β-strand | 205-209 | 5 | 32 |
| β-strand | 215-218 | 4 | 33 |
| β-strand | 225-234 | 10 | 33 |
| β-strand | 241-250 | 10 | 33 |
| β-strand | 252 | 1 | 34 |
| β-strand | 255 | 1 | 34 |
| β-strand | 261-264 | 4 | 33 |
| α-helix | 271-272 | 2 | |
| β-strand | 273 | 1 | 33 |
| α-helix | 274-281 | 8 | |
| α-helix | 286-293 | 8 | |
| α-helix | 301-305 | 5 | |
| α-helix | 307-312 | 6 | |
| α-helix | 319-327 | 9 | |
| α-helix | 338-350 | 13 | |
| α-helix | 364-382 | 19 | |
| α-helix | 387-390 | 4 | |
| α-helix | 394-396 | 3 | |
| β-strand | 397-400 | 4 | 32 |
| α-helix | 402-430 | 29 | |
| α-helix | 444-456 | 13 | |
| β-strand | 459 | 1 | 35 |
| α-helix | 462-464 | 3 | |
| β-strand | 469 | 1 | 35 |
| β-strand | 473-475 | 3 | 31 |
| α-helix | 481-487 | 7 | |
| β-strand | 490-492 | 3 | 32 |
| α-helix | 509-511 | 3 | |
| β-strand | 515 | 1 | 36 |
| α-helix | 523-525 | 3 | |
| β-strand | 529-531 | 3 | 32 |
| β-strand | 532 | 1 | 36 |
| β-strand | 537-538 | 2 | 37 |
| α-helix | 545-554 | 10 | |
| α-helix | 556 | 1 | |
| β-strand | 557 | 1 | 38 |
| α-helix | 558 | 1 | |
| α-helix | 559-561 | 3 | |
| α-helix | 570 | 1 | |
| β-strand | 571-575 | 5 | 38 |
| β-strand | 578-583 | 6 | 38 |
| α-helix | 586-599 | 14 | |
| β-strand | 607-611 | 5 | 38 |
| β-strand | 616-620 | 5 | 38 |
| β-strand | 626-632 | 7 | 37 |
| β-strand | 633 | 1 | 39 |
| β-strand | 645 | 1 | 39 |
| α-helix | 649-657 | 9 | |
| α-helix | 678-683 | 6 | |
| β-strand | 687-691 | 5 | 37 |
| α-helix | 692-695 | 4 | |
| β-strand | 700-701 | 2 | 37 |
| α-helix | 704-707 | 4 | |
| β-strand | 740-741 | 2 | 37 |
| α-helix | 745-748 | 4 | |
| α-helix | 753-755 | 3 | |
| α-helix | 759-761 | 3 | |
| β-strand | 762 | 1 | 40 |
| α-helix | 764-773 | 10 | |
| α-helix | 774-776 | 3 | |
| β-strand | 777 | 1 | 41 |
| β-strand | 779 | 1 | 42 |
| β-strand | 792-796 | 5 | 42 |
| β-strand | 800 | 1 | 43 |
| β-strand | 804-805 | 2 | 44 |
| α-helix | 809-812 | 4 | |
| β-strand | 821-827 | 7 | 45 |
| β-strand | 838-842 | 5 | 45 |
| α-helix | 843-847 | 5 | |
| β-strand | 853-862 | 10 | 42 |
| β-strand | 865 | 1 | 46 |
| β-strand | 871 | 1 | 46 |
| β-strand | 873-874 | 2 | 47 |
| β-strand | 882-883 | 2 | 47 |
| β-strand | 898 | 1 | 48 |
| α-helix | 899-900 | 2 | |
| β-strand | 904-905 | 2 | 42 |
| β-strand | 910-912 | 3 | 48 |
| β-strand | 914-917 | 4 | 47 |
| α-helix | 918-919 | 2 | |
| β-strand | 934-936 | 3 | 47 |
| β-strand | 939-940 | 2 | 48 |
| α-helix | 941-942 | 2 | |
| β-strand | 947-956 | 10 | 42 |
| β-strand | 962-972 | 11 | 42 |
| β-strand | 979-982 | 4 | 45 |
| β-strand | 987-994 | 8 | 45 |
| β-strand | 1001-1002 | 2 | 49 |
| β-strand | 1010-1012 | 3 | 45 |
| α-helix | 1014-1016 | 3 | |
| β-strand | 1022 | 1 | 40 |
| α-helix | 1023-1038 | 16 | |
| α-helix | 1041 | 1 | |
| β-strand | 1042-1043 | 2 | 44 |
| α-helix | 1052-1061 | 10 | |
| β-strand | 1069-1070 | 2 | 45 |
| β-strand | 1072-1073 | 2 | 49 |
| α-helix | 1079 | 1 | |
| β-strand | 1080 | 1 | 49 |
| α-helix | 1081 | 1 | |
| β-strand | 1085-1094 | 10 | 45 |
| β-strand | 1095 | 1 | 41 |
| α-helix | 1099-1101 | 3 | |
| β-strand | 1104-1106 | 3 | 11 |
| β-strand | 1111 | 1 | 50 |
| β-strand | 1118 | 1 | 50 |
| α-helix | 1119 | 1 | |
| β-strand | 1128-1130 | 3 | 10 |
| α-helix | 1132-1141 | 10 | |
| α-helix | 1144-1151 | 8 | |
| β-strand | 1157-1163 | 7 | 1 |
| β-strand | 1171-1174 | 4 | 51 |
| β-strand | 1179-1182 | 4 | 51 |
| β-strand | 1187 | 1 | 51 |
| β-strand | 1191-1197 | 7 | 1 |
| α-helix | 1198-1209 | 12 | |
| β-strand | 1212 | 1 | 3 |
| β-strand | 1215-1217 | 3 | 2 |
Chain c: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-36 | 10 | |
| β-strand | 42-43 | 2 | 78 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 79 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 80 |
Chain C: 10 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-12 | 7 | 52 |
| β-strand | 16-22 | 7 | 52 |
| α-helix | 26-38 | 13 | |
| β-strand | 42-53 | 12 | 53 |
| α-helix | 59-67 | 9 | |
| β-strand | 71-73 | 3 | 54 |
| α-helix | 76-78 | 3 | |
| β-strand | 96-103 | 8 | 53 |
| β-strand | 111-114 | 4 | 55 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-122 | 4 | 53 |
| β-strand | 129-132 | 4 | 54 |
| α-helix | 133 | 1 | |
| β-strand | 143-147 | 5 | 55 |
| β-strand | 152-162 | 11 | 53 |
| α-helix | 168-170 | 3 | |
| β-strand | 173 | 1 | 56 |
| β-strand | 177-180 | 4 | 52 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-209 | 3 | |
| α-helix | 211-214 | 4 | |
| β-strand | 227-233 | 7 | 52 |
| β-strand | 234 | 1 | 56 |
| α-helix | 240-263 | 24 | |
Chain d: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 79 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 78 |
| α-helix | 91-101 | 11 | |
| α-helix | 104-122 | 19 | |
Chain D: 11 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 57 |
| β-strand | 24 | 1 | 58 |
| α-helix | 25-27 | 3 | |
| β-strand | 29 | 1 | 58 |
| β-strand | 37-39 | 3 | 59 |
| β-strand | 45-47 | 3 | 59 |
| β-strand | 51 | 1 | 57 |
| α-helix | 53-71 | 19 | |
| α-helix | 86-89 | 4 | |
| α-helix | 90-92 | 3 | |
| α-helix | 96-110 | 15 | |
| α-helix | 118-128 | 11 | |
| α-helix | 139-147 | 9 | |
| α-helix | 153-159 | 7 | |
| α-helix | 164-166 | 3 | |
| α-helix | 171-181 | 11 | |
| α-helix | 182-184 | 3 | |
11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase subunit | A | protein | 1743 | Komagataella phaffii | C4R4Y0 |
| DNA-directed RNA polymerase subunit beta | B | protein | 1227 | Komagataella phaffii | C4QZQ7 (AlphaFold model) |
| RNA polymerase II third largest subunit B44, part of central core | C | protein | 304 | Komagataella phaffii | C4R7L2 (AlphaFold model) |
| RNA polymerase II subunit B32 | D | protein | 186 | Komagataella phaffii | C4R2U9 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC1 | E | protein | 214 | Komagataella phaffii | C4R3P8 |
| RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III | F | protein | 155 | Komagataella phaffii | C4R1V1 |
| RNA polymerase II subunit | G | protein | 171 | Komagataella phaffii | C4R9A1 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 145 | Komagataella phaffii | C4R273 |
| DNA-directed RNA polymerase subunit | I | protein | 115 | Komagataella phaffii | F2QPE6 |
| RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III | J | protein | 72 | Komagataella phaffii | C4R009 |
| RNA polymerase II subunit B12.5 | K | protein | 118 | Komagataella phaffii | C4R3Z5 |
| RNA polymerase subunit ABC10-alpha | L | protein | 72 | Komagataella phaffii | F2QMI1 |
7 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>8JH3_1 DNA-directed RNA polymerase subunit (chains A)
MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGS
IDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNP
TMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGM
KLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVL
PVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFH
VATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNL
ELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHK
RAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYN
ADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDT
FIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLS
PKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLH
NGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVS
RTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGF
ADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQR
RLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYV
DLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPV
NLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLF
QCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQ
MTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSI
EYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELD
RARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEED
QMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVM
AVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTS
RGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMG
TGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFS
PMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGY
SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYS
PTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESK
EGE
Sequence of entity 2 (B), FASTA
>8JH3_2 DNA-directed RNA polymerase subunit beta (chains B)
MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQ
PAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDME
KSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDL
YKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSR
LISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDW
QMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQE
EGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTRE
IYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYT
YSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISI
GSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSG
AISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYD
DDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLN
DTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIA
PGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEG
LKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKK
LMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAA
KLLFQELMAMNIAPRLYTERSGVSMRS
Sequence of entity 3 (C), FASTA
>8JH3_3 RNA polymerase II third largest subunit B44, part of central core (chains C)
MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADE
FISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIK
VSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEY
DPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKA
NQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDY
NAPY
Sequence of entity 4 (D), FASTA
>8JH3_4 RNA polymerase II subunit B32 (chains D)
MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLI
REALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEET
CTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNR
LEDPYK
Sequence of entity 5 (E), FASTA
>8JH3_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFL
ANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSAN
KMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQRE
DPVARYLGLKRGQVVKIIRRSETSGRYASYRICL
Sequence of entity 6 (F), FASTA
>8JH3_6 RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III (chains F)
MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGT
IKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQI
AMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN
Sequence of entity 7 (G), FASTA
>8JH3_7 RNA polymerase II subunit (chains G)
MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGR
IIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLV
YNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI
Sequence of entity 8 (H), FASTA
>8JH3_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLA
NSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGL
LMCLEGGYKSLASLKQDNLYILIRR
Sequence of entity 9 (I), FASTA
>8JH3_9 DNA-directed RNA polymerase subunit (chains I)
MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVD
DIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE
Sequence of entity 10 (J), FASTA
>8JH3_10 RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III (chains J)
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFL
RYNPLEKKDFDS
Sequence of entity 11 (K), FASTA
>8JH3_11 RNA polymerase II subunit B12.5 (chains K)
MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVA
YKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND
Sequence of entity 12 (L), FASTA
>8JH3_12 RNA polymerase subunit ABC10-alpha (chains L)
MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYK
ARTKRMIQFDAR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 8 |
Primary citation
Cryo-EM structures of RNA polymerase II-nucleosome complexes rewrapping transcribed DNA. Akatsu, M., Ehara, H., Kujirai, T. et al. J Biol Chem (2023) 299:105477-105477. DOI 10.1016/j.jbc.2023.105477 · PubMed
Other PDB entries of the same protein (UniProt C4R4Y0), best resolution first:
- 5XOG 3.0 Å, RNA Polymerase II elongation complex bound with Spt5 KOW5 and Elf1
- 7XN7 3.1 Å, RNA polymerase II elongation complex containing Spt4/5, Elf1, Spt6, Spn1 and Paf1C
- 8JH4 3.2 Å, RNA polymerase II elongation complex containing 60 bp upstream DNA loop, stalled at…
- 8YFQ 3.3 Å, Cryo EM structure of Komagataella phaffii RNAPII-Rat1-Rai1 pre-termination complex
- 7XSZ 3.4 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC115)
- 8YFR 3.4 Å, Cryo EM structure of Komagataella phaffii Rat1-Rai1 complex bound within the RNAPII cleft
- 9WMS 3.4 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
- 9II7 3.5 Å, RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome containing…
- 9WMT 3.59 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
- 7XSE 3.6 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC42)
- 9UJS 3.62 Å, RNA polymerase II elongation complex stalled at SHL(-4) of the H3-H4 octasome
- 9WMW 3.62 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
Browse structure collections
About this viewer
MolViewer shows 8JH3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.