7PKS: Integrator-mediated transcription regulation

Name: PDB 7PKS: Structural basis of Integrator-mediated transcription regulation
Published: 2021-12-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structural basis of Integrator-mediated transcription regulation. Determined by electron microscopy at 3.6 Å resolution. Released 8 Dec 2021.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Sus scrofa domesticus, Human immunodeficiency virus 1, Homo sapiens
Chains: 33
Atoms: 101,147
Mol. weight: 2033.4 kDa
Ligands: MN, ZN, MG
Released: 8 Dec 2021

Explore 7PKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PKS contains 778 α-helices and 408 β-strands across 30 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 78 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	367-374	8
α-helix	381-397	17
α-helix	412-414	3
α-helix	421-430	10
α-helix	431-433	3
α-helix	436-447	12
α-helix	448-451	4
α-helix	460-467	8
α-helix	473-486	14
α-helix	492-506	15
α-helix	512-520	9
α-helix	534-550	17
α-helix	555-566	12
α-helix	572-596	25
α-helix	605-615	11
α-helix	636-643	8
α-helix	650-661	12
α-helix	669-685	17
α-helix	698-709	12
α-helix	730-743	14
α-helix	762-772	11
α-helix	785-803	19
α-helix	851-860	10
α-helix	950-964	15
α-helix	969-977	9
α-helix	978-980	3
α-helix	984-997	14
α-helix	1021-1025	5
α-helix	1026-1030	5
α-helix	1039-1042	4
α-helix	1044-1053	10
α-helix	1060-1072	13
α-helix	1080-1094	15
α-helix	1098-1103	6
β-strand	1105	1	111
β-strand	1108	1	111
α-helix	1111-1131	21
α-helix	1165-1174	10
α-helix	1184-1192	9
α-helix	1219-1222	4
α-helix	1229-1236	8
α-helix	1241-1247	7
α-helix	1255-1271	17
α-helix	1273-1279	7
α-helix	1284-1294	11
α-helix	1302-1311	10
α-helix	1313-1315	3
α-helix	1362-1368	7
α-helix	1374-1392	19
α-helix	1402-1414	13
α-helix	1421-1427	7
α-helix	1429-1445	17
α-helix	1452-1467	16
α-helix	1476-1488	13
α-helix	1489-1491	3
α-helix	1493-1494	2
α-helix	1497-1509	13
α-helix	1514-1530	17
α-helix	1538-1551	14
α-helix	1556-1565	10
α-helix	1579-1588	10
α-helix	1612-1614	3
α-helix	1615-1625	11
α-helix	1634-1641	8
α-helix	1657-1667	11
α-helix	1670-1681	12
α-helix	1691-1702	12
α-helix	1729-1747	19
α-helix	1756-1768	13
α-helix	2048-2055	8
α-helix	2060-2076	17
α-helix	2078-2084	7
α-helix	2085-2091	7
α-helix	2097-2113	17
α-helix	2115-2121	7
α-helix	2122-2129	8
α-helix	2134-2142	9
α-helix	2144-2151	8
α-helix	2156-2168	13
α-helix	2174-2188	15

Chain A: 73 helices, 65 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	48	1	4
β-strand	51	1	4
α-helix	52-53	2
β-strand	88-95	8	5
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	6
β-strand	117	1	6
α-helix	124-132	9
α-helix	138-148	11
α-helix	186-188	3
β-strand	190-194	5	7
β-strand	197-201	5	7
β-strand	213-216	4	7
α-helix	218-226	9
α-helix	230-235	6
α-helix	245-248	4
β-strand	249-253	5	5
α-helix	275-292	18
α-helix	293-297	5
α-helix	302-318	17
α-helix	350-353	4
β-strand	357-358	2	8
β-strand	362-369	8	9
β-strand	377-380	4	9
α-helix	382-385	4
β-strand	389-393	5	10
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	10
β-strand	426-428	3	10
β-strand	445-449	5	10
α-helix	450	1
β-strand	455-459	5	9
α-helix	466-468	3
β-strand	469-476	8	9
β-strand	482-484	3	9
α-helix	486-488	3
α-helix	489-492	4
β-strand	500-504	5	9
α-helix	509-518	10
β-strand	520	1	9
α-helix	522-524	3
β-strand	526	1	11
β-strand	533	1	11
α-helix	539-548	10
β-strand	554-555	2	12
α-helix	557-563	7
α-helix	564-566	3
α-helix	573-574	2
β-strand	575	1	13
α-helix	576-577	2
β-strand	579-581	3	14
β-strand	585	1	14
β-strand	586-587	2	12
α-helix	588-595	8
β-strand	602-605	4	15
β-strand	627-631	5	15
β-strand	634-637	4	15
α-helix	642-645	4
α-helix	652-660	9
α-helix	662-683	22
β-strand	686	1	16
α-helix	689-691	3
α-helix	696-721	26
α-helix	726-728	3
α-helix	733-758	26
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	17
β-strand	793	1	18
β-strand	796	1	18
β-strand	822-823	2	17
α-helix	833-867	35
β-strand	872-873	2	19
β-strand	879-880	2	19
β-strand	886-888	3	19
α-helix	891-893	3
β-strand	896	1	20
β-strand	902-905	4	21
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	22
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	21
α-helix	983-993	11
β-strand	1002	1	22
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1077	16
β-strand	1080	1	20
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1121-1128	8
β-strand	1139-1142	4	23
β-strand	1143	1	24
α-helix	1145-1148	4
α-helix	1151-1161	11
β-strand	1164	1	25
α-helix	1166-1168	3
β-strand	1170-1177	8	26
α-helix	1190-1194	5
β-strand	1210-1216	7	26
α-helix	1218-1223	6
α-helix	1228-1239	12
α-helix	1240-1242	3
β-strand	1243-1248	6	26
β-strand	1255-1261	7	26
α-helix	1281-1294	14
β-strand	1299	1	25
β-strand	1306-1310	5	23
β-strand	1319-1322	4	27
β-strand	1328-1331	4	27
β-strand	1335-1339	5	23
α-helix	1343-1347	5
β-strand	1352	1	24
β-strand	1358-1359	2	23
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1405	11
β-strand	1408	1	28
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1462-1464	3
α-helix	1467-1469	3
β-strand	1471-1475	5	29
α-helix	1479-1482	4

Chain b: 77 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-27	8
α-helix	31-34	4
α-helix	39-54	16
α-helix	62-77	16
α-helix	81-88	8
α-helix	92-106	15
α-helix	126-132	7
α-helix	135-155	21
α-helix	175-187	13
α-helix	194-200	7
α-helix	207-217	11
α-helix	219-221	3
α-helix	222-230	9
α-helix	241-256	16
α-helix	261-271	11
α-helix	275-284	10
α-helix	297-306	10
α-helix	311-326	16
α-helix	335-347	13
α-helix	382-394	13
α-helix	395-399	5
α-helix	405-415	11
α-helix	423-438	16
α-helix	440-442	3
α-helix	446-461	16
α-helix	476-488	13
α-helix	494-503	10
α-helix	511-514	4
α-helix	515-520	6
α-helix	521-525	5
α-helix	528-537	10
α-helix	539-540	2
β-strand	544	1	112
α-helix	553-562	10
α-helix	565-568	4
α-helix	574-582	9
β-strand	584	1	112
α-helix	588-589	2
α-helix	592-604	13
α-helix	610-614	5
α-helix	617-620	4
α-helix	621-623	3
α-helix	645-665	21
α-helix	678-680	3
α-helix	681-685	5
α-helix	689-698	10
α-helix	706-717	12
α-helix	719-721	3
α-helix	724-726	3
α-helix	728-730	3
α-helix	736-744	9
α-helix	745-747	3
α-helix	754-761	8
α-helix	768-778	11
α-helix	787-789	3
α-helix	790-795	6
α-helix	799-801	3
α-helix	807-820	14
α-helix	825-835	11
α-helix	850-855	6
α-helix	857-861	5
α-helix	867-869	3
α-helix	871-900	30
α-helix	923-945	23
α-helix	950-953	4
α-helix	989-1007	19
α-helix	1009-1018	10
α-helix	1022-1024	3
α-helix	1025-1031	7
α-helix	1033-1035	3
α-helix	1038-1045	8
α-helix	1051-1067	17
α-helix	1071-1090	20
α-helix	1093-1103	11
α-helix	1105-1113	9
α-helix	1115-1117	3
α-helix	1118-1138	21
α-helix	1147-1149	3
α-helix	1181-1201	21

Chain B: 57 helices, 83 β-strands

Element	Residues	Length	Sheet
α-helix	17-18	2
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
β-strand	65-67	3	34
β-strand	84-93	10	34
β-strand	97-98	2	35
β-strand	106-107	2	35
α-helix	110-115	6
β-strand	121-131	11	34
β-strand	141-153	13	34
α-helix	168-173	6
β-strand	185-187	3	36
β-strand	190-194	5	36
α-helix	195	1
β-strand	196-200	5	37
α-helix	201	1
β-strand	205-209	5	38
β-strand	215-223	9	38
α-helix	230	1
α-helix	232	1
β-strand	233-240	8	38
β-strand	256-259	4	38
α-helix	260	1
β-strand	263	1	39
β-strand	267-268	2	38
α-helix	269-275	7
α-helix	282-288	7
α-helix	295-307	13
α-helix	314-322	9
β-strand	325	1	39
α-helix	332-341	10
α-helix	342-346	5
α-helix	358-377	20
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	37
α-helix	396-423	28
α-helix	431-434	4
α-helix	437-450	14
β-strand	453	1	40
β-strand	463	1	40
β-strand	467-469	3	36
α-helix	470-471	2
α-helix	475-482	8
β-strand	484-486	3	37
α-helix	496-499	4
α-helix	503-505	3
β-strand	509	1	41
β-strand	523-525	3	37
β-strand	526	1	41
β-strand	531-532	2	42
α-helix	539-547	9
α-helix	550	1
β-strand	551-552	2	43
α-helix	553-555	3
α-helix	558-560	3
β-strand	565-569	5	43
β-strand	572-577	6	43
α-helix	580-592	13
β-strand	602-606	5	43
β-strand	611-615	5	43
β-strand	621-627	7	42
β-strand	628-629	2	44
β-strand	632-633	2	44
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	42
α-helix	667-670	4
β-strand	675-676	2	42
α-helix	679-681	3
β-strand	695-696	2	42
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	45
α-helix	719-728	10
β-strand	732	1	46
β-strand	748-751	4	47
β-strand	755	1	48
β-strand	759-760	2	49
α-helix	762-765	4
β-strand	776-782	7	50
β-strand	783	1	16
β-strand	793-797	5	50
α-helix	798-802	5
β-strand	808-817	10	47
β-strand	820	1	51
β-strand	826	1	51
β-strand	827-829	3	52
β-strand	837-838	2	52
α-helix	845-847	3
β-strand	848	1	53
β-strand	853	1	54
β-strand	854	1	53
α-helix	855	1
β-strand	859-860	2	47
β-strand	865-867	3	54
β-strand	869-872	4	52
β-strand	889-891	3	52
β-strand	894-895	2	54
β-strand	902-911	10	47
β-strand	917-927	11	47
β-strand	934-937	4	50
β-strand	942-949	8	50
β-strand	956	1	55
β-strand	965-967	3	50
α-helix	969-971	3
β-strand	977	1	45
α-helix	978-993	16
β-strand	997-998	2	49
α-helix	1008-1016	9
β-strand	1025-1026	2	50
β-strand	1029	1	55
α-helix	1035	1
β-strand	1036	1	55
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	50
β-strand	1051	1	46
α-helix	1055-1057	3
β-strand	1060-1062	3	9
β-strand	1067	1	56
β-strand	1074	1	56
α-helix	1082-1084	3
β-strand	1085-1086	2	8
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
β-strand	1127-1129	3	57
β-strand	1134-1136	3	57
β-strand	1137	1	58
β-strand	1142	1	58
β-strand	1146-1150	5	1
α-helix	1153-1164	12
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain C: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	61
β-strand	18-24	7	61
α-helix	28-40	13
β-strand	44-55	12	62
α-helix	61-69	9
β-strand	73	1	63
α-helix	82-84	3
β-strand	98-106	9	62
α-helix	112	1
β-strand	113-115	3	64
β-strand	121-122	2	62
β-strand	129	1	63
α-helix	130-132	3
β-strand	151-153	3	64
β-strand	158-168	11	62
α-helix	174-176	3
β-strand	179-185	7	61
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	61
α-helix	241-270	30

Chain d: 50 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	36-45	10
α-helix	51-59	9
α-helix	66-82	17
α-helix	86-99	14
α-helix	107-109	3
α-helix	111-119	9
α-helix	124-140	17
α-helix	145-158	14
α-helix	164-176	13
α-helix	196-202	7
α-helix	203-205	3
α-helix	209-225	17
α-helix	227-229	3
α-helix	232-240	9
α-helix	246-262	17
β-strand	267-269	3	113
β-strand	276-278	3	113
α-helix	279-291	13
α-helix	296-307	12
α-helix	314-319	6
α-helix	378-383	6
α-helix	388-404	17
α-helix	406-419	14
α-helix	425-437	13
α-helix	442-443	2
β-strand	444	1	114
α-helix	446-455	10
α-helix	461-472	12
β-strand	476	1	114
α-helix	479-495	17
α-helix	497-499	3
α-helix	500-513	14
α-helix	515-518	4
α-helix	519-521	3
α-helix	522-525	4
α-helix	534-538	5
α-helix	542-557	16
α-helix	567-579	13
α-helix	609-623	15
α-helix	629-647	19
α-helix	654-674	21
α-helix	677-680	4
α-helix	688-690	3
α-helix	693-709	17
β-strand	711	1	115
α-helix	716-739	24
α-helix	745-764	20
α-helix	769-771	3
α-helix	776-782	7
α-helix	784-789	6
α-helix	792-803	12
α-helix	806-808	3
α-helix	811-814	4
β-strand	819	1	115
β-strand	821-824	4	116
β-strand	835-838	4	117
β-strand	843-846	4	118
β-strand	849-852	4	116
α-helix	857-860	4
β-strand	861-866	6	119
β-strand	874-875	2	119
α-helix	879-881	3
β-strand	882-886	5	116
β-strand	889-892	4	116
β-strand	895-898	4	118
β-strand	903	1	120
β-strand	910-917	8	119
β-strand	944-947	4	119
β-strand	952-953	2	119
β-strand	956-959	4	117

Chain D: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	72
β-strand	21	1	72
β-strand	30-31	2	73
α-helix	34-50	17
α-helix	55-57	3
α-helix	59-70	12
α-helix	77-87	11
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain e: 50 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	291-302	12
α-helix	309-317	9
α-helix	339-344	6
α-helix	350-361	12
α-helix	367-375	9
α-helix	381-398	18
α-helix	403-412	10
α-helix	429-450	22
α-helix	467-469	3
α-helix	472-475	4
α-helix	478-480	3
α-helix	481-488	8
α-helix	495-509	15
α-helix	515-525	11
α-helix	529-542	14
α-helix	549-562	14
α-helix	568-586	19
α-helix	590-595	6
α-helix	599-604	6
α-helix	607-610	4
α-helix	611-615	5
α-helix	619-631	13
α-helix	633-635	3
α-helix	641-661	21
α-helix	664-667	4
α-helix	668-678	11
α-helix	682-696	15
α-helix	703-705	3
α-helix	727-734	8
α-helix	759-760	2
α-helix	769-787	19
β-strand	788	1	121
α-helix	789-790	2
α-helix	802-803	2
β-strand	804	1	121
α-helix	805	1
α-helix	806-820	15
α-helix	831-833	3
α-helix	834-836	3
α-helix	841-853	13
α-helix	856-865	10
α-helix	868-874	7
α-helix	875-891	17
α-helix	901-916	16
α-helix	924-929	6
α-helix	931-933	3
α-helix	936-952	17
α-helix	957-959	3
β-strand	960-963	4	122
β-strand	968-971	4	122
α-helix	974-976	3
α-helix	984-994	11
α-helix	996-999	4
α-helix	1001-1006	6

22 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1970	Sus scrofa domesticus	A0A7M4DUC2
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa domesticus	A0A0B8RVL1 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa domesticus	A0A481DF93 (AlphaFold model)
RNA polymerase II subunit D	D	protein	142	Sus scrofa domesticus	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa domesticus	I3LSI7
DNA-directed RNA polymerase II subunit F	F	protein	127	Sus scrofa domesticus	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa domesticus	I3LJZ9
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa domesticus	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa domesticus	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa domesticus	A0A7K6NXI9
RNA_pol_L_2 domain-containing protein	K	protein	117	Sus scrofa domesticus	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa domesticus	A0A4X1TRS6

21 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>7PKS_1 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>7PKS_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>7PKS_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>7PKS_4 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>7PKS_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>7PKS_6 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>7PKS_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>7PKS_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>7PKS_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>7PKS_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>7PKS_11 RNA_pol_L_2 domain-containing protein (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>7PKS_12 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	2
ZN	Zinc ion	Zn	10
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of Integrator-mediated transcription regulation. Fianu, I., Chen, Y., Dienemann, C. et al. Science (2021) 374:883-887. DOI 10.1126/science.abk0154 · PubMed

Other PDB entries of the same protein (UniProt A0A7M4DUC2), best resolution first:

9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
8A40 3.0 Å, Structure of mammalian Pol II-TFIIS elongation complex
6TED 3.1 Å, Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers…
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex
9ER2 3.3 Å, PolII-TCR-STK19 structure.

Browse structure collections

About this viewer

MolViewer shows 7PKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.