8OU0: Bovine sperm endpiece singlet microtubules

bovine sperm endpiece singlet microtubules (one tubulin dimer and associated microtubule inner proteins). Determined by electron microscopy at 3.5 Å resolution. Released 5 Jul 2023.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Bos taurus
Chains: 4
Atoms: 8,139
Mol. weight: 180.69 kDa
Ligands: GDP, GTP, MG
Released: 5 Jul 2023

Explore 8OU0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OU0 contains 53 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	5
α-helix	10-28	19
β-strand	35	1	6
α-helix	49-51	3
β-strand	53	1	7
β-strand	60	1	6
β-strand	63	1	7
β-strand	65-68	4	5
α-helix	73-80	8
β-strand	92-93	2	5
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-113	3
α-helix	115-128	14
β-strand	132-140	9	5
α-helix	144-160	17
β-strand	165-171	7	5
α-helix	172-174	3
α-helix	183-194	12
β-strand	200-204	5	5
α-helix	206-212	7
α-helix	213-217	5
α-helix	224-243	20
β-strand	248	1	8
α-helix	253-259	7
β-strand	262	1	9
β-strand	265	1	9
β-strand	269-273	5	8
α-helix	278-282	5
α-helix	288-294	7
α-helix	298-300	3
α-helix	307-309	3
β-strand	312-321	10	8
α-helix	325-337	13
β-strand	343	1	8
β-strand	351-356	6	8
β-strand	373-381	9	8
α-helix	384-400	17
α-helix	405-411	7
α-helix	415-436	22

Chain B: 20 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	10-27	18
β-strand	30	1	2
β-strand	35	1	3
β-strand	36	1	2
β-strand	53-56	4	3
β-strand	60-63	4	3
β-strand	65-69	5	1
α-helix	72-80	9
α-helix	89-91	3
β-strand	92-94	3	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-128	18
β-strand	132-140	9	1
α-helix	145-160	16
β-strand	165-171	7	1
α-helix	183-197	15
β-strand	200-204	5	1
α-helix	207-215	9
α-helix	224-239	16
α-helix	240-242	3
β-strand	248	1	4
α-helix	252-259	8
β-strand	267-268	2	1
β-strand	269-273	5	4
α-helix	288-295	8
β-strand	301	1	4
α-helix	307-309	3
β-strand	312-320	9	4
α-helix	325-338	14
α-helix	340-342	3
β-strand	343	1	4
β-strand	351-355	5	4
α-helix	359-360	2
β-strand	374-381	8	4
α-helix	384-400	17
α-helix	406-409	4
α-helix	415-434	20

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-21	16
α-helix	23-36	14
α-helix	47-55	9
α-helix	62-86	25
α-helix	93-105	13
α-helix	123-125	3
α-helix	128-129	2
α-helix	130-134	5
α-helix	138-140	3
α-helix	142-156	15

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	254-257	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin beta-4B chain	B	protein	445	Bos taurus	Q3MHM5 (AlphaFold model)
Stabilizer of axonemal microtubules 1	D	protein	477	Bos taurus	A0A3S5ZPV0 (AlphaFold model)
Sperm acrosome associated 9	C	protein	224	Bos taurus	A0A3Q1MYU9 (AlphaFold model)
Tubulin alpha-3 chain	A	protein	450	Bos taurus	Q32KN8 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8OU0_1 Tubulin beta-4B chain (chains B)
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA

Sequence of entity 2 (D), FASTA

>8OU0_2 Stabilizer of axonemal microtubules 1 (chains D)
MAPTKGKCVCELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPVYHSYLPRESFKPKM
DYQRACTPMEGLTTSRRDFGPHKVLPVKIHQPNPFVPSEENMDLQTTYKQDYNPYPLCRV
DPFKPRDSKYPCGDKMESLPTYKADYLPWNQPRRELLRPPHHYRPASTKFDSRTTQQDDY
SMKGLVNTRSCKPPAVPKLCNVPLEDLTNYKMSYVAHPLEKRFVHESEKFRPCEIPFESL
TTHKESYRGLMGEPAKSLKPPARPYGLDTPFSNTTEFRDKYQAWPTPQVFSKPPSMYVPP
EEKMDLLTTVQTHYTYPKGAPAESCRPALSVKKGGRFEGSTTTKEDYKQWASTRTEPAKP
IPQLNLPTEPLDCLTTARAHYVPHLPMMTKSCKPVWSGPQGNIPVEGQTTYTISFTPKEM
SRCLASYPEPPGYIFEEIDALGHRIYRPVSQTGSRRSSRFSVGDSENPNQQELTVSA

Sequence of entity 3 (C), FASTA

>8OU0_3 Sperm acrosome associated 9 (chains C)
MMNEVKESLRSVEQKYKIFQQQQFTFIGALEHCRENAHDKIRPISSIGQVQSYMEHHCSN
STDRRILLMFLDICSELSKLCQHFEALHAGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPH
DVVNHLSCDEARNHYGGVVSLIPIILDLMKEWVAHSEKLPRKALQQVSEPQAATRATAHA
PQASGTQPQLRKQNCGQLIQNIPKPGGKDQGSSKPPWRPPGGKL

Sequence of entity 4 (A), FASTA

>8OU0_4 Tubulin alpha-3 chain (chains A)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKLDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structural specializations of the sperm tail. Leung, M.R., Zeng, J., Wang, X. et al. Cell (2023) 186:2880-2896.e17. DOI 10.1016/j.cell.2023.05.026 · PubMed

Other PDB entries of the same protein (UniProt Q3MHM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RRO 3.4 Å, Structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia
9CPB 3.52 Å, Atomic model of bovine Fallopian tube cilia doublet microtubule (48-nm periodicity)
8OTZ 3.6 Å, 48-nm repeat of the native axonemal doublet microtubule from bovine sperm
9FQR 5.0 Å, 96-nm repeat of axonemal doublet microtubules from bovine sperm

Browse structure collections

About this viewer

MolViewer shows 8OU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.