8OWI: Corona-targeting domain of CENP-E

Crystal structure of the corona-targeting domain of CENP-E. Determined by X-ray diffraction at 2.14 Å resolution. Released 21 Jun 2023.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 971
Mol. weight: 34.78 kDa
Released: 21 Jun 2023

Explore 8OWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OWI contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2455-2507	53

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2455-2506	52

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere-associated protein E	A, B	protein	150	Homo sapiens	Q02224 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8OWI_1 Centromere-associated protein E (chains A, B)
GPSPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQ
AQDTSVISEHTDPQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIK
QKNELLSNNQHLSNEVKTWKERTLKREAHK

Primary citation

A conserved CENP-E region mediates BubR1-independent recruitment to the outer corona at mitotic onset. Weber, J., Legal, T., Lezcano, A.P. et al. Curr Biol (2024) 34:1133-1141.e4. DOI 10.1016/j.cub.2024.01.042 · PubMed

Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HFH 1.8 Å, CENP-E motor domain in complex with AMPPNP and Mg2+
6M4I 1.9 Å, Structure of CENP-E motor domain at 1.9 angstrom resolution
5JVP 2.1 Å, The neck-linker and alpha 7 helix of Homo sapiens CENP-E
1T5C 2.5 Å, Crystal structure of the motor domain of human kinetochore protein CENP-E
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E

Browse structure collections

About this viewer

MolViewer shows 8OWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.