8PYK: Human IGF1R with inhibitor 47

Human IGF1R with inhibitor 47. Determined by X-ray diffraction at 2.23 Å resolution. Released 20 Sept 2023.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,284
Mol. weight: 37.33 kDa
Ligands: IC2, NI
Released: 20 Sept 2023

Explore 8PYK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PYK contains 18 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	993	1	1
α-helix	996-998	3
β-strand	999-1006	8	1
β-strand	1013-1022	10	1
β-strand	1025-1034	10	1
α-helix	1041-1051	11
α-helix	1052-1056	5
β-strand	1062	1	2
α-helix	1063-1064	2
β-strand	1065-1069	5	1
β-strand	1076-1080	5	1
β-strand	1086	1	2
α-helix	1087-1093	7
α-helix	1109-1128	20
α-helix	1138-1140	3
β-strand	1141-1143	3	2
β-strand	1149-1151	3	2
α-helix	1162-1164	3
β-strand	1166-1167	2	3
β-strand	1173-1174	2	3
α-helix	1176-1178	3
α-helix	1181-1186	6
α-helix	1191-1206	16
α-helix	1210-1211	2
α-helix	1218-1226	9
α-helix	1231-1234	4
α-helix	1239-1248	10
α-helix	1253-1255	3
α-helix	1257-1258	2
α-helix	1259-1268	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 1 receptor beta chain	AAA	protein	321	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>8PYK_1 Insulin-like growth factor 1 receptor beta chain (chains AAA)
MASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAI
KTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLR
SLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP
YQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEP
GFREVSFYYSEENKAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
IC2	5,5-dimethyl-1-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-3-[4-(trifluoromethylsulfa…	C20 H17 F3 N4 O2 S	1
NI	Nickel (II) ion	Ni	3

Primary citation

Human IGF1R with inhibitor 47. Dreyer, M.K., Wang, J., Elkins, J.M. To be published.

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 8PYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.