8PYN: Human IGF1R with inhibitor 56

Human IGF1R with inhibitor 56. Determined by X-ray diffraction at 1.71 Å resolution. Released 20 Sept 2023.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,396
Mol. weight: 37.42 kDa
Ligands: ZN, NI, CD, ICV
Released: 20 Sept 2023

Explore 8PYN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PYN contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	993	1	1
α-helix	996-998	3
β-strand	999-1007	9	1
β-strand	1012-1022	11	1
β-strand	1025-1034	10	1
α-helix	1041-1053	13
α-helix	1054-1056	3
β-strand	1062	1	2
α-helix	1063-1064	2
β-strand	1065-1069	5	1
β-strand	1076-1080	5	1
β-strand	1085-1086	2	2
α-helix	1087-1093	7
α-helix	1109-1128	20
α-helix	1138-1140	3
β-strand	1141-1143	3	2
β-strand	1149-1151	3	2
α-helix	1159-1164	6
β-strand	1166-1167	2	3
α-helix	1168-1170	3
β-strand	1173-1174	2	3
α-helix	1176-1178	3
α-helix	1181-1186	6
α-helix	1191-1207	17
α-helix	1210-1211	2
α-helix	1218-1226	9
α-helix	1231-1234	4
α-helix	1239-1248	10
α-helix	1253-1255	3
α-helix	1257-1258	2
α-helix	1259-1267	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 1 receptor beta chain	AAA	protein	321	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>8PYN_1 Insulin-like growth factor 1 receptor beta chain (chains AAA)
MASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAI
KTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLR
SLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP
YQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEP
GFREVSFYYSEENKAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
NI	Nickel (II) ion	Ni	1
CD	Cadmium ion	Cd	1
ICV	5,5-dimethyl-1-(1H-pyrrolo[2,3-b]pyridin-4-ylmethyl)-3-[4-(trifluoromethylsulfo…	C20 H17 F3 N4 O4 S	1

Primary citation

Human IGF1R with inhibitor 56. Dreyer, M.K., Wang, J., Elkins, J.M. To be published.

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 8PYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.