8R58: The RSK 2 N-terminal kinase domain

The RSK 2 N-terminal kinase domain in complex with BMF (1-19). Determined by X-ray diffraction at 2.31 Å resolution. Released 27 Nov 2024.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,379
Mol. weight: 39.12 kDa
Ligands: QCT
Released: 27 Nov 2024

Explore 8R58 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R58 contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	50-56	7	1
α-helix	57	1
α-helix	60-62	3
α-helix	65-67	3
β-strand	68-75	8	2
α-helix	77-79	3
β-strand	81-87	7	2
β-strand	96-102	7	2
β-strand	105-111	7	1
α-helix	112	1
β-strand	130-131	2	3
β-strand	133-139	7	2
β-strand	142-147	6	2
β-strand	154-155	2	3
α-helix	156-162	7
α-helix	164-166	3
α-helix	167-186	20
α-helix	196-198	3
β-strand	199-201	3	3
β-strand	207-210	4	3
β-strand	212-215	4	1
α-helix	232-234	3
α-helix	237-240	4
α-helix	248-263	16
α-helix	273-282	10
β-strand	285	1	4
α-helix	293-302	10
β-strand	304	1	5
α-helix	307-309	3
α-helix	318-322	5
α-helix	325-327	3
α-helix	332-336	5
α-helix	341-342	2
α-helix	345-347	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	5
β-strand	15	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase alpha-3	A	protein	317	Homo sapiens	P51812 (AlphaFold model)
Bcl-2-modifying factor	B	protein	19	Homo sapiens	Q96LC9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8R58_1 Ribosomal protein S6 kinase alpha-3 (chains A)
GSASNPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDAR
QLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGD
LFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGL
SKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRK
ETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNK
LYRREIHPPFKPATGRP

Sequence of entity 2 (B), FASTA

>8R58_2 Bcl-2-modifying factor (chains B)
MEPSQCVEELEDDVFQPED

Ligands and cofactors

ID	Name	Formula	Copies
QCT	2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl…	C21 H20 O11	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

A new kinase docking system for RSK AGC kinase domain. Alexa, A., Sok, P., Remenyi, A. To be published.

Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NW6 1.74 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
8EQ5 1.8 Å, Crystal structure of the N-terminal kinase domain of RSK2 in complex with SPRED2 (131-160)
4NW5 1.94 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8
5D9L 2.15 Å, Rsk2 N-terminal Kinase in Complex with bis-phenol pyrazole
4NUS 2.39 Å, Rsk2 N-terminal kinase in complex with LJH685
4D9T 2.4 Å, Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl…
4D9U 2.4 Å, Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H…
5D9K 2.55 Å, Rsk2 N-terminal Kinase in Complex with BI-D1870
4JG6 2.6 Å, RSK2 CTD bound to 2-cyano-3-(1H-indazol-5-yl)acrylamide
8XEY 2.65 Å, The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus
7OPO 2.75 Å, RSK2 N-terminal kinase domain in complex with ORF45
4JG7 3.0 Å, Structure of RSK2 CTD bound to 3-(3-(1H-pyrrolo[2,3-b]pyridine-3-carbonyl)phenyl)-2-cyano…

Browse structure collections

About this viewer

MolViewer shows 8R58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.