8SV1: Caspase-1 complex with interleukin-18

Caspase-1 complex with interleukin-18. Determined by electron microscopy at 3.5 Å resolution. Released 8 May 2024.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,330
Mol. weight: 97.43 kDa
Released: 8 May 2024

Explore 8SV1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SV1 contains 18 α-helices and 68 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	152	1	11
β-strand	164-169	6	12
α-helix	182-196	15
β-strand	199-204	6	12
α-helix	208-219	12
α-helix	224-226	3
β-strand	230-235	6	12
β-strand	238	1	13
β-strand	242-244	3	13
β-strand	255-257	3	13
α-helix	258-263	6
α-helix	271-273	3
β-strand	279-283	5	12
β-strand	292-294	3	5

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	152	1	1
β-strand	165-169	5	2
α-helix	182-196	15
β-strand	200-204	5	2
α-helix	208-220	13
α-helix	222-226	5
β-strand	231-235	5	2
β-strand	238-239	2	3
β-strand	242-244	3	3
β-strand	255-256	2	3
α-helix	258-264	7
α-helix	271-273	3
β-strand	278-283	6	2
β-strand	295-296	2	4

Chain b: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	318-319	2	4
β-strand	328	1	12
β-strand	331	1	14
β-strand	340-341	2	15
β-strand	342	1	16
β-strand	346	1	16
α-helix	348-360	13
α-helix	366-375	10
β-strand	388	1	14
β-strand	389	1	10
β-strand	392	1	9
β-strand	397	1	11

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	320-322	3	5
β-strand	327-328	2	2
β-strand	331	1	6
β-strand	340-341	2	7
β-strand	342	1	8
β-strand	346	1	8
α-helix	348-360	13
α-helix	366-375	10
β-strand	388	1	6
β-strand	389	1	9
β-strand	392	1	10
β-strand	397	1	1

Chains c and C: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	20
β-strand	23	1	20
β-strand	24-25	2	21
α-helix	33	1
β-strand	34-35	2	15
β-strand	45-46	2	21
β-strand	84-88	5	22
β-strand	97-102	6	22
β-strand	108-111	4	22
β-strand	118-121	4	22
β-strand	137-141	5	22
β-strand	148-153	6	22
β-strand	161-166	6	21
β-strand	169-174	6	21
β-strand	185-187	3	21
β-strand	188-190	3	22
α-helix	191-192	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-1	A, a	protein	148	Homo sapiens	P29466 (AlphaFold model)
Caspase-1	B, b	protein	88	Homo sapiens	P29466 (AlphaFold model)
Interleukin-18	C, c	protein	188	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A, a), FASTA

>8SV1_1 Caspase-1 (chains A, a)
AEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTAS
DMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
CPSLKDKPKVIIIQACRGDSPGVVWFKD

Sequence of entity 2 (B, b), FASTA

>8SV1_2 Caspase-1 (chains B, b)
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS
FEQPDGRAQMPTTERVTLTRCFYLFPGH

Sequence of entity 3 (C, c), FASTA

>8SV1_3 Interleukin-18 (chains C, c)
VEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPL
FEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPP
DNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSI
MFTVQNED

Primary citation

Structural transitions enable interleukin-18 maturation and signaling. Dong, Y., Bonin, J.P., Devant, P. et al. Immunity (2024) 57:1533-1548.e10. DOI 10.1016/j.immuni.2024.04.015 · PubMed

Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8WRA 1.45 Å, The Crystal Structure of CASP1 from Biortus
6BZ9 1.8 Å, Crystal structure of human caspase-1 in complex with Ac-FLTD-CMK
1SC3 1.8 Å, Crystal structure of the human caspase-1 C285A mutant in complex with malonate
2H54 1.8 Å, Crystal structure of human caspase-1 (Thr388->Ala) in complex with…
2HBQ 1.8 Å, Crystal structure of wildtype human caspase-1 in complex with…
3D6M 1.8 Å, Crystal structure of human caspase-1 with a naturally-occurring Lys319->Arg substitution…
6F6R 1.8 Å, Crystal structure of human Caspase-1 with N-{3-[1-((S)-2-Hydroxy-5-oxo-tetrahydro-furan-3…
1RWX 1.85 Å, Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-b…
2H4Y 1.9 Å, Crystal structure of human caspase-1 (Arg286->Lys) in complex with…
2HBZ 1.9 Å, Crystal structure of human caspase-1 (Arg286->Ala, Glu390->Ala) in complex with…
3D6F 1.9 Å, Crystal structure of human caspase-1 with a naturally-occurring Arg240->Gln substitution…
6PZP 1.94 Å, Crystal structure of caspase-1 in complex with VX-765

Browse structure collections

About this viewer

MolViewer shows 8SV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.