8T2L: LC3A

Crystal structure of LC3A in complex with the LIR of NSs4. Determined by X-ray diffraction at 2.24 Å resolution. Released 3 Apr 2024.

Method: X-ray diffraction
Resolution: 2.24 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,150
Mol. weight: 30.86 kDa
Released: 3 Apr 2024

Explore 8T2L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T2L contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	79-83	5	1
β-strand	87	1	1
β-strand	94	1	2
α-helix	95-102	8
α-helix	108	1
β-strand	109-115	7	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	3
α-helix	60-70	11
β-strand	80-83	4	1
β-strand	87	1	1
β-strand	94	1	3
α-helix	95-102	8
β-strand	109-114	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein S,Microtubule-associated proteins 1A/1B light chain 3A chimera	A, B	protein	132	Homo sapiens	Q9H492 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8T2L_1 Non-structural protein S,Microtubule-associated proteins 1A/1B light chain 3A chimera (chains A, B)
GSDDDGFVEVDMPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDK
TKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFL
YMVYASQETFGF

Primary citation

An LIR motif in the Rift Valley fever virus NSs protein is critical for the interaction with LC3 family members and inhibition of autophagy. Petraccione, K., Ali, M.G.H., Cyr, N. et al. PLoS Pathog (2024) 20:e1012093-e1012093. DOI 10.1371/journal.ppat.1012093 · PubMed

Other PDB entries of the same protein (UniProt Q9H492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RA0 1.36 Å, LC3A in complex with Fragment 2-10
6TBE 1.67 Å, LC3A in complex with (3R,4S,5R,6R)-5-hydroxy-6-((4-hydroxy-3-(4-hydroxy-3-isopentylbenzam…
7R9Z 1.72 Å, LC3A in complex with Fragment 2-3
7R9W 1.75 Å, LC3A in complex with Fragment 1-1
3WAN 1.77 Å, Crystal structure of Atg13 LIR-fused human LC3A_2-121
4ZDV 1.8 Å, Crystal structure of LC3 in complex with FAM134B LIR
8T36 1.85 Å, Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
3WAL 2.0 Å, Crystal structure of human LC3A_2-121
5CX3 2.3 Å, Crystal structure of FYCO1 LIR in complex with LC3A
8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR
5DPR 2.5 Å, Crystal structure of PLEKHM1 LIR-fused human LC3A_2-121

Browse structure collections

About this viewer

MolViewer shows 8T2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.