8TIN: Human ACKR3 phosphorylated by GRK2

Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without receptor/micelle. Determined by electron microscopy at 4.0 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 4.0 Å
Organisms: synthetic construct, Bos taurus, Homo sapiens
Chains: 4
Atoms: 5,515
Mol. weight: 138.65 kDa
Released: 22 Jan 2025

Explore 8TIN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TIN contains 8 α-helices and 69 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	6
β-strand	20-23	4	6
β-strand	28-29	2	7
β-strand	30	1	8
β-strand	35	1	8
β-strand	38-43	6	6
α-helix	46-49	4
β-strand	53-59	7	9
β-strand	62-63	2	10
β-strand	77	1	10
β-strand	82-88	7	9
α-helix	100-107	8
β-strand	113-118	6	6
β-strand	128-130	3	10
β-strand	142-143	2	10
β-strand	146-152	7	9
β-strand	165-167	3	9
β-strand	171-172	2	7
β-strand	184-188	5	11
β-strand	198-204	7	11
β-strand	208	1	12
β-strand	215-223	9	11
β-strand	232-242	11	13
β-strand	250	1	13
β-strand	253-259	7	13
β-strand	267-275	9	11
β-strand	289-291	3	10
β-strand	301	1	10
β-strand	318-328	11	13
β-strand	337-341	5	13
β-strand	343	1	12
α-helix	346-348	3

Chain H: 2 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	20-28	9	1
β-strand	35-42	8	2
β-strand	48-55	8	2
β-strand	60-63	4	2
β-strand	68	1	1
β-strand	71-76	6	1
β-strand	81-87	7	1
β-strand	95-103	9	2
β-strand	121-122	2	2
β-strand	126-128	3	2
β-strand	136	1	3
β-strand	139-143	5	4
β-strand	155-164	10	4
β-strand	165	1	3
α-helix	168	1
β-strand	169	1	5
β-strand	172-173	2	5
β-strand	183-189	7	4
β-strand	195-203	9	4
α-helix	205-207	3
β-strand	213-219	7	5
β-strand	224-230	7	5

Chain L: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	14
β-strand	11-12	2	15
β-strand	20-25	6	14
β-strand	35-39	5	16
β-strand	41	1	17
β-strand	43	1	17
β-strand	63-67	5	14
β-strand	71-76	6	14
β-strand	86-91	6	16
β-strand	98-99	2	16
β-strand	104-105	2	15
β-strand	115-119	5	18
α-helix	123-128	6
β-strand	130-140	11	18
β-strand	145-150	6	19
β-strand	160-162	3	18
α-helix	164-166	3
β-strand	174-183	10	18
α-helix	184-189	6
β-strand	192-199	8	19
β-strand	206-211	6	19

Chain R: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	352-354	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab7 heavy chain	H	protein	240	synthetic construct
Beta-arrestin-2	A	protein	392	Bos taurus	P32120 (AlphaFold model)
Fab7 light chain	L	protein	215	synthetic construct
Atypical chemokine receptor 3	R	protein	393	Homo sapiens	P25106 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>8TIN_1 Fab7 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSSSYIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARKSMYHRGWGWLSWVYGAMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 2 (A), FASTA

>8TIN_2 Beta-arrestin-2 (chains A)
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AVPETDAPVDTNLIEFETNYATDDDIVFEDFA

Sequence of entity 3 (L), FASTA

>8TIN_3 Fab7 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYYPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (R), FASTA

>8TIN_4 Atypical chemokine receptor 3 (chains R)
GAPDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIG
MIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCK
VTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLP
DTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARA
ISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALH
VTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALE
QSTKGRPLEVLFQGPHHHHHHHHHHDYKDDDDK

Primary citation

Effect of phosphorylation barcodes on arrestin binding to a chemokine receptor. Chen, Q., Schafer, C.T., Mukherjee, S. et al. Nature (2025) 643:280-287. DOI 10.1038/s41586-025-09024-9 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8TIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.