8TVL: PDB entry 8TVL

Plasminogen binding group A streptococcus M-like protein from AP53 bound to human plasminogen. Determined by electron microscopy at 3.8 Å resolution. Released 11 Oct 2023.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Streptococcus pyogenes
Chains: 1
Atoms: 2,706
Mol. weight: 40.66 kDa
Released: 11 Oct 2023

Explore 8TVL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TVL contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	79-81	3
α-helix	138-145	8
α-helix	146-150	5
α-helix	164-166	3
α-helix	178-181	4
α-helix	183-186	4
α-helix	191	1
α-helix	192-196	5
α-helix	198-201	4
α-helix	222-233	12
α-helix	237-240	4
α-helix	264-271	8
α-helix	281-290	10
α-helix	293-298	6
α-helix	319-322	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen-binding group A streptococcal M-like protein PAM	A	protein	356	Streptococcus pyogenes	P49054 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TVL_1 Plasminogen-binding group A streptococcal M-like protein PAM (chains A)
NRADDARNEVLRGNLVRAELWYRQIQENDQLKLENKGLKTDLREKEEELQGLKDDVEKLT
ADAELQRLKNERHEEAELERLKSERHDHDKKEAERKALEDKLADKQEHLNGALRYINEKE
AERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQ
ISDASRQGLRRDLDASREAKKQVEKGLANLTAELDKVKEEKQISDASRQGLRRDLDASRE
AKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAE
ELAKLRAEKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTG

Primary citation

Plasminogen binding group A streptococcus M-like protein from AP53 bound to human plasminogen. Readnour, B.M., Tjia-Fleck, S.K., McCann, N.R. et al. To be published.

Other PDB entries of the same protein (UniProt P49054 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
2DOH 2.3 Å, The X-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound a…
1I5K 2.7 Å, Structure and binding determinants of the recombinant kringle-2 domain of human…
2DOI 3.1 Å, The X-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound…
6OKW Solution structure of VEK50
6OKX Solution structure of VEK50RH1/AA
6OKY Solution structure of truncated peptide from PAMap53
6OQ9 Solution structure of VEK50 in the bound form with plasminogen kringle 2
6OQJ Solution structure of the complex of mutant VEK50[RH1/AA] and plasminogen kringle 2
6OQK Solution structure of the complex of mutant VEK50[RH2/AA] and plasminogen kringle 2

Browse structure collections

About this viewer

MolViewer shows 8TVL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.