1I5K: Plasminogen

Structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group A streptococcal surface protein. Determined by X-ray diffraction at 2.7 Å resolution. Released 1 Aug 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,870
Mol. weight: 26.82 kDa
Released: 1 Aug 2001

Explore 1I5K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I5K contains 11 α-helices and 21 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	15	1	2
β-strand	16	1	3
α-helix	20	1
β-strand	21	1	2
β-strand	22-23	2	4
α-helix	24	1
α-helix	41-43	3
β-strand	51	1	4
β-strand	60-63	4	4
β-strand	70-72	3	4
β-strand	73	1	3
α-helix	75-76	2
β-strand	77	1	1

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	102	1	5
β-strand	115	1	6
β-strand	116	1	7
α-helix	120	1
β-strand	121	1	6
β-strand	122	1	8
α-helix	123-124	2
α-helix	137-139	3
α-helix	141-143	3
β-strand	151	1	9
β-strand	160-162	3	9
β-strand	163	1	8
β-strand	170-172	3	9
β-strand	173	1	7
α-helix	175-176	2
β-strand	177	1	5

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	306-326	21

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	406-426	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A, B	protein	84	Homo sapiens	P00747 (AlphaFold model)
M protein	C, D	protein	30		P49054 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1I5K_1 PLASMINOGEN (chains A, B)
FSEECMHGSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRD
LRPWCFTTDPNKRWEYCDIPRCAA

Sequence of entity 2 (C, D), FASTA

>1I5K_2 M PROTEIN (chains C, D)
VEKLTADAELQRLKNERHEEAELERLKSEY

Primary citation

Structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group A Streptococcal surface protein. Rios-Steiner, J.L., Schenone, M., Mochalkin, I. et al. J Mol Biol (2001) 308:705-719. DOI 10.1006/jmbi.2001.4646 · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor

Browse structure collections

About this viewer

MolViewer shows 1I5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.