8V29: Oncostatin-M

Cryo-EM structure of human type I OSM receptor complex: model for full extracellular assembly. Determined by electron microscopy at 3.99 Å resolution. Released 20 Nov 2024.

Method: Electron microscopy
Resolution: 3.99 Å
Organism: Homo sapiens
Chains: 3
Atoms: 12,457
Mol. weight: 190.37 kDa
Ligands: NAG
Released: 20 Nov 2024

Explore 8V29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8V29 contains 50 α-helices and 119 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	35-49	15
α-helix	52-62	11
α-helix	68-71	4
α-helix	76-77	2
α-helix	84-89	6
α-helix	93-116	24
α-helix	120-126	7
α-helix	131-157	27
α-helix	184-211	28

Chain B: 23 helices, 50 β-strands

Element	Residues	Length	Sheet
β-strand	29-32	4	1
α-helix	38-39	2
β-strand	44-50	7	1
α-helix	51	1
α-helix	52-58	7
α-helix	62-64	3
β-strand	66-68	3	2
β-strand	73	1	2
α-helix	76-78	3
β-strand	79-83	5	1
β-strand	86-91	6	1
β-strand	101-106	6	2
β-strand	112-118	7	2
β-strand	133-137	5	3
β-strand	142-145	4	3
β-strand	157-163	7	4
β-strand	168-171	4	4
α-helix	173-175	3
β-strand	181-183	3	3
β-strand	194-202	9	4
β-strand	205-208	4	4
β-strand	212-214	3	4
α-helix	216-219	4
β-strand	220-221	2	3
α-helix	222-225	4
β-strand	226-231	6	5
β-strand	240-245	6	5
α-helix	248-250	3
β-strand	255-263	9	6
α-helix	268-269	2
β-strand	270-271	2	6
α-helix	272-273	2
α-helix	274-276	3
β-strand	283-286	4	5
β-strand	294-303	10	6
α-helix	310-315	6
β-strand	317-320	4	6
α-helix	322-324	3
β-strand	332-336	5	7
β-strand	341	1	8
β-strand	344	1	8
β-strand	345-351	7	7
α-helix	352-355	4
α-helix	356-359	4
β-strand	365-372	8	9
β-strand	377-382	6	9
β-strand	386-391	6	7
β-strand	396-403	8	9
β-strand	408	1	9
β-strand	414-416	3	9
α-helix	417	1
α-helix	421-423	3
β-strand	428-434	7	10
β-strand	439-444	6	10
α-helix	445-446	2
β-strand	452-459	8	11
β-strand	469-474	6	11
β-strand	479-481	3	10
β-strand	491-499	9	11
β-strand	504	1	11
β-strand	508-513	6	11
α-helix	522-524	3
β-strand	525-530	6	12
β-strand	535-539	5	12
α-helix	540-543	4
α-helix	544-547	4
β-strand	553-560	8	13
β-strand	566-571	6	13
β-strand	576-579	4	12
α-helix	582-583	2
β-strand	587-595	9	13
β-strand	600-602	3	13
β-strand	606-609	4	13

Chain C: 18 helices, 69 β-strands

Element	Residues	Length	Sheet
β-strand	53-57	5	14
β-strand	62-67	6	14
α-helix	68-70	3
β-strand	78-79	2	15
β-strand	82-84	3	15
β-strand	93	1	15
β-strand	97-101	5	14
β-strand	108-115	8	15
β-strand	121-127	7	15
β-strand	133-134	2	14
α-helix	136-139	4
β-strand	141-147	7	16
β-strand	152-158	7	16
α-helix	161-163	3
β-strand	169-178	10	17
β-strand	186-193	8	17
β-strand	200-206	7	16
α-helix	211-213	3
β-strand	216-225	10	17
β-strand	232-233	2	14
α-helix	235-241	7
β-strand	242-244	3	17
β-strand	254-255	2	18
β-strand	260-262	3	19
β-strand	267-271	5	18
β-strand	277-282	6	20
β-strand	285-287	3	20
β-strand	290-291	2	18
β-strand	297-301	5	18
β-strand	312-318	7	20
β-strand	322-327	6	20
β-strand	328-330	3	19
α-helix	332-336	5
β-strand	337-343	7	21
β-strand	348-354	7	21
α-helix	363-365	3
α-helix	366-367	2
β-strand	368-373	6	22
β-strand	379-381	3	22
α-helix	389-391	3
β-strand	394-398	5	21
β-strand	405-413	9	22
β-strand	418-426	9	22
β-strand	431	1	21
α-helix	433-436	4
β-strand	437-445	9	23
β-strand	448-458	11	23
β-strand	463-472	10	24
β-strand	478-485	8	24
β-strand	488-497	10	23
β-strand	504-513	10	24
α-helix	519-522	4
β-strand	526-529	4	24
β-strand	541-545	5	25
β-strand	551-556	6	25
α-helix	557-559	3
α-helix	561-564	4
β-strand	570-574	5	26
β-strand	575-576	2	27
β-strand	584-588	5	26
β-strand	593-597	5	25
β-strand	604-607	4	27
β-strand	608-610	3	26
β-strand	615	1	26
α-helix	616-618	3
β-strand	619-622	4	27
β-strand	624	1	28
β-strand	633-637	5	29
β-strand	638-639	2	30
β-strand	642-646	5	30
β-strand	656-663	8	29
α-helix	669-670	2
β-strand	673-678	6	29
β-strand	683-686	4	30
β-strand	697-704	8	29
β-strand	708	1	28
β-strand	709-718	10	29
α-helix	727-729	3
β-strand	730-735	6	31
β-strand	740-744	5	31
α-helix	745-748	4
α-helix	749-752	4
β-strand	756-765	10	32
β-strand	783-788	6	32
β-strand	795-798	4	31
β-strand	806-815	10	32
β-strand	818-828	11	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oncostatin-M	A	protein	196	Homo sapiens	P13725 (AlphaFold model)
Interleukin-6 receptor subunit beta	B	protein	625	Homo sapiens	P40189 (AlphaFold model)
Leukemia inhibitory factor receptor	C	protein	817	Homo sapiens	P42702 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8V29_1 Oncostatin-M (chains A)
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEE
TLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILG
LRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSV
GRVFSKWGESPNRSRR

Sequence of entity 2 (B), FASTA

>8V29_2 Interleukin-6 receptor subunit beta (chains B)
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTII
NRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKM
RCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAEN
ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYR
TKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITY
EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTV
NATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVE
WTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYAD
GPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTII
GNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEEQK
LISEEDLGGEQKLISEEDLHHHHHH

Sequence of entity 3 (C), FASTA

>8V29_3 Leukemia inhibitory factor receptor (chains C)
QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALS
HGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVF
PHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYI
DNLHFSGLEEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGH
TNCPLIHLDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETH
DLKEIICSWNPGRVTALVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQE
IYNFTLNAHNPLGRSQSTILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINF
LCEIEIKKSNSVQEQRNVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSN
KKQHLTTEASPSKGPDTWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSL
SEIPDPQHKAEIRLDKNDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGIL
LTWHYDPNMTCDYVIKWCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFFLYGC
RNQGYQLLRSMIGYIEELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFG
KGERDTSKMRVLESGRSDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKS
MYVVTKENSEQKLISEEDLGGEQKLISEEDLHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	9

Primary citation

Structures of complete extracellular assemblies of type I and type II Oncostatin M receptor complexes. Zhou, Y., Stevis, P.E., Cao, J. et al. Nat Commun (2024) 15:9776-9776. DOI 10.1038/s41467-024-54124-1 · PubMed

Other PDB entries of the same protein (UniProt P13725 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EVS 2.2 Å, Crystal structure of human oncostatin M
9VWO 2.45 Å, human OSM in complex with Nb3.30
9VWP 3.03 Å, human OSM in complex with Nb3.43
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region

Browse structure collections

About this viewer

MolViewer shows 8V29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.