8W0F: Human MCM2-7 double hexamer on dsDNA

Name: PDB 8W0F: Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
Published: 2024-10-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA. Determined by electron microscopy at 2.8 Å resolution. Released 2 Oct 2024.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 14
Atoms: 63,321
Mol. weight: 1128.44 kDa
Ligands: ZN, ADP, ATP, MG
Released: 2 Oct 2024

Explore 8W0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W0F contains 365 α-helices and 368 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 2: 30 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-205	17
α-helix	214-225	12
β-strand	229-233	5	1
α-helix	234-240	7
α-helix	242-250	9
α-helix	252-270	19
α-helix	272-276	5
β-strand	282-286	5	1
β-strand	291	1	2
α-helix	294-296	3
α-helix	299-301	3
β-strand	304-315	12	2
β-strand	319-328	10	2
β-strand	335-340	6	2
α-helix	341-342	2
β-strand	362-363	2	2
β-strand	369-379	11	2
β-strand	393-399	7	2
β-strand	411-419	9	2
β-strand	434	1	3
β-strand	438-446	9	2
α-helix	460-468	9
α-helix	473-479	7
α-helix	489-500	12
β-strand	505	1	4
β-strand	513	1	4
β-strand	519-523	5	5
α-helix	529-539	11
β-strand	543-547	5	5
β-strand	559-562	4	6
β-strand	569-572	4	6
α-helix	575-578	4
β-strand	583-587	5	5
α-helix	589-591	3
α-helix	594-606	13
β-strand	608-612	5	7
β-strand	617-621	5	7
β-strand	627-630	4	5
α-helix	643-646	4
α-helix	651-655	5
β-strand	659-663	5	5
α-helix	669-685	17
α-helix	688-690	3
α-helix	713-716	4
α-helix	717-729	13
β-strand	734	1	8
α-helix	740-756	17
α-helix	760-762	3
α-helix	764-781	18
β-strand	785	1	8
α-helix	788-805	18
α-helix	808-817	10
α-helix	819-822	4
α-helix	828-848	21

Chain 3: 28 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	9
α-helix	10-23	14
α-helix	31-42	12
β-strand	46-50	5	10
α-helix	51-57	7
α-helix	59-67	9
α-helix	69-87	19
α-helix	89-94	6
β-strand	99-103	5	10
β-strand	110-111	2	11
α-helix	118-120	3
β-strand	121	1	11
β-strand	124-134	11	11
β-strand	138-147	10	12
β-strand	154-158	5	12
α-helix	169-172	4
β-strand	177	1	13
β-strand	183	1	13
β-strand	185-196	12	12
β-strand	197-202	6	11
α-helix	213-214	2
β-strand	216-221	6	11
β-strand	234-244	11	11
β-strand	251-253	3	14
β-strand	255-256	2	15
β-strand	257-267	11	11
α-helix	270-272	3
α-helix	278-290	13
α-helix	295-303	9
α-helix	311-322	12
β-strand	327-328	2	16
β-strand	334-335	2	16
β-strand	341-345	5	17
α-helix	351-361	11
β-strand	365-369	5	17
α-helix	375-377	3
β-strand	381-384	4	18
β-strand	391-394	4	18
α-helix	397-400	4
β-strand	405-409	5	17
α-helix	411-413	3
α-helix	416-421	6
α-helix	423-428	6
β-strand	430-434	5	19
β-strand	439-443	5	19
β-strand	447-452	6	17
α-helix	465-468	4
α-helix	473-478	6
β-strand	481-485	5	17
α-helix	491-506	16
β-strand	516	1	20
α-helix	532-534	3
β-strand	545	1	21
α-helix	550-553	4
β-strand	563	1	21
α-helix	565-577	13
β-strand	581-582	2	22
α-helix	584-598	15
β-strand	607-609	3	23
α-helix	615-631	17
β-strand	636-637	2	22
α-helix	639-652	14
β-strand	654-656	3	23

Chain 4: 29 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	116-118	3
β-strand	126-128	3	24
β-strand	150-152	3	24
α-helix	159-172	14
α-helix	192-203	12
β-strand	207-211	5	25
α-helix	212-218	7
α-helix	220-228	9
α-helix	230-247	18
β-strand	259-263	5	25
α-helix	271-273	3
α-helix	276-278	3
β-strand	282-292	11	26
β-strand	296-306	11	26
β-strand	312-316	5	26
β-strand	321-324	4	27
β-strand	327	1	28
β-strand	334	1	28
β-strand	337-356	20	26
α-helix	365-367	3
β-strand	368-375	8	26
β-strand	387-397	11	26
β-strand	400	1	29
β-strand	408-409	2	29
β-strand	411	1	30
α-helix	412	1
β-strand	413-422	10	26
α-helix	432-436	5
α-helix	443-454	12
α-helix	458-465	8
α-helix	474-485	12
β-strand	506-509	4	31
α-helix	516-526	11
β-strand	530-534	5	31
β-strand	538	1	32
α-helix	540-544	5
β-strand	545-550	6	33
β-strand	555-560	6	33
α-helix	562-565	4
β-strand	570-574	5	31
α-helix	581-584	4
α-helix	587-593	7
β-strand	595-599	5	34
β-strand	604-608	5	34
α-helix	611	1
β-strand	612-617	6	31
α-helix	618-619	2
α-helix	620-622	3
α-helix	630-634	5
α-helix	638-643	6
β-strand	646-649	4	31
α-helix	656-670	15
α-helix	684-696	13
β-strand	702	1	35
α-helix	704-721	18
α-helix	731-748	18
β-strand	753	1	35
α-helix	755-767	13

Chain 5: 26 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	36
α-helix	25-27	3
α-helix	28-40	13
β-strand	43-46	4	37
β-strand	50-53	4	37
α-helix	54-65	12
β-strand	69-73	5	38
α-helix	74-80	7
α-helix	82-90	9
α-helix	92-110	19
α-helix	114-115	2
α-helix	121-123	3
β-strand	125-129	5	38
α-helix	133-136	4
α-helix	137-139	3
β-strand	148-158	11	39
α-helix	159-161	3
β-strand	162-172	11	15
β-strand	178	1	15
β-strand	182-183	2	15
α-helix	184-185	2
β-strand	189	1	40
β-strand	190-192	3	14
β-strand	196	1	41
α-helix	206-207	2
β-strand	209	1	41
β-strand	212-224	13	15
β-strand	225-230	6	39
β-strand	244-249	6	39
β-strand	262-271	10	39
β-strand	273	1	40
β-strand	289	1	2
β-strand	292-301	10	39
α-helix	316-327	12
α-helix	331-339	9
α-helix	347-358	12
β-strand	363-364	2	42
β-strand	370-371	2	42
β-strand	377-381	5	43
α-helix	387-397	11
β-strand	401-405	5	43
β-strand	408	1	43
β-strand	409	1	44
β-strand	412	1	44
β-strand	417-420	4	45
β-strand	427-430	4	45
α-helix	433-436	4
β-strand	440-445	6	43
α-helix	452-462	11
β-strand	466-470	5	46
β-strand	475-479	5	46
β-strand	482-488	7	43
α-helix	497-499	3
α-helix	508-512	5
β-strand	516-520	5	43
α-helix	526-542	17
α-helix	556-569	14
β-strand	570	1	20
β-strand	573-574	2	47
α-helix	576-600	25
α-helix	610-627	18
β-strand	631-632	2	47
α-helix	634-648	15

Chain 6: 27 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	21-36	16
α-helix	45-50	6
α-helix	51-54	4
β-strand	60-64	5	48
α-helix	65-71	7
α-helix	73-81	9
α-helix	83-101	19
β-strand	111-115	5	48
β-strand	121	1	49
α-helix	128-130	3
β-strand	131	1	49
β-strand	134-144	11	49
β-strand	148-158	11	3
β-strand	164-169	6	3
β-strand	191-203	13	3
β-strand	204-209	6	49
α-helix	220-222	3
β-strand	223-228	6	49
β-strand	241-252	12	49
β-strand	263-266	4	27
α-helix	272-273	2
α-helix	280-287	8
β-strand	290-291	2	27
β-strand	294-305	12	49
α-helix	322-328	7
α-helix	331-342	12
α-helix	346-354	9
α-helix	362-373	12
β-strand	378-379	2	50
β-strand	385-386	2	50
β-strand	392-396	5	51
α-helix	402-412	11
β-strand	416-420	5	51
β-strand	424	1	34
α-helix	426-429	4
β-strand	431-435	5	52
β-strand	442-446	5	52
α-helix	448-451	4
β-strand	456-460	5	51
α-helix	462-464	3
α-helix	467-479	13
β-strand	481-486	6	53
β-strand	489-494	6	53
β-strand	498-503	6	51
α-helix	504-505	2
α-helix	516-519	4
α-helix	524-528	5
β-strand	532-536	5	51
α-helix	542-557	16
α-helix	569-579	11
β-strand	585-586	2	54
α-helix	588-605	18
β-strand	612	1	55
α-helix	618-634	17
β-strand	639-640	2	54
α-helix	642-655	14
β-strand	658	1	55

Chain 7: 31 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
α-helix	32-41	10
β-strand	47-51	5	56
α-helix	52-56	5
α-helix	60-68	9
α-helix	70-88	19
α-helix	98-112	15
α-helix	119-121	3
α-helix	128-131	4
β-strand	135-139	5	56
α-helix	154-156	3
β-strand	160-170	11	30
α-helix	171-173	3
β-strand	174-184	11	30
β-strand	190-194	5	30
β-strand	199-200	2	29
β-strand	205	1	57
α-helix	209-214	6
β-strand	219	1	57
β-strand	220-238	19	30
α-helix	241-243	3
α-helix	249-251	3
β-strand	252-258	7	30
α-helix	259-261	3
β-strand	270-281	12	30
β-strand	293	1	12
β-strand	294-305	12	30
α-helix	307-309	3
α-helix	321-328	8
α-helix	332-339	8
α-helix	348-359	12
β-strand	364	1	58
β-strand	371	1	58
β-strand	377-381	5	59
α-helix	387-397	11
β-strand	401-405	5	59
α-helix	411-413	3
β-strand	417-420	4	60
β-strand	427-430	4	60
α-helix	433-437	5
β-strand	441-445	5	59
α-helix	447-449	3
α-helix	452-464	13
β-strand	466-469	4	61
β-strand	470	1	32
β-strand	476-479	4	61
β-strand	483-488	6	59
α-helix	509-512	4
β-strand	517-521	5	59
α-helix	527-543	17
α-helix	546-548	3
α-helix	552-555	4
α-helix	556-567	12
β-strand	572	1	62
α-helix	577-594	18
α-helix	603-620	18
β-strand	624	1	62
α-helix	627-644	18

Chain A: 31 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-204	16
β-strand	207	1	63
β-strand	213	1	63
α-helix	214-225	12
β-strand	229-233	5	64
α-helix	234-240	7
α-helix	242-247	6
α-helix	252-270	19
α-helix	272-276	5
β-strand	282-286	5	64
β-strand	291	1	65
α-helix	294-296	3
α-helix	299-301	3
β-strand	305-315	11	65
β-strand	319-329	11	65
β-strand	335-340	6	65
β-strand	361-363	3	65
β-strand	369-379	11	65
α-helix	389-392	4
β-strand	393-399	7	65
β-strand	411-419	9	65
β-strand	434	1	66
β-strand	438-446	9	65
α-helix	459-469	11
α-helix	473-480	8
α-helix	489-500	12
β-strand	505	1	67
β-strand	513	1	67
β-strand	519-523	5	68
α-helix	529-539	11
β-strand	543-547	5	68
β-strand	559-562	4	69
β-strand	569-572	4	69
β-strand	583-587	5	68
α-helix	594-606	13
β-strand	608-612	5	70
β-strand	617-621	5	70
α-helix	624	1
β-strand	625-630	6	68
α-helix	633-635	3
α-helix	643-647	5
α-helix	651-655	5
β-strand	659-663	5	68
α-helix	669-686	18
α-helix	713-716	4
α-helix	717-729	13
β-strand	734	1	71
α-helix	740-756	17
α-helix	760-762	3
α-helix	764-780	17
β-strand	785	1	71
α-helix	788-804	17
α-helix	808-817	10
α-helix	819-822	4
α-helix	829-850	22
α-helix	862-870	9
α-helix	878-881	4

Chain B: 35 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	12
α-helix	10-24	15
α-helix	31-42	12
β-strand	46-50	5	72
α-helix	51-57	7
α-helix	59-67	9
α-helix	69-87	19
α-helix	89-94	6
β-strand	99-103	5	72
β-strand	110-111	2	9
α-helix	118-120	3
β-strand	124-134	11	9
β-strand	138-148	11	9
β-strand	153-158	6	9
β-strand	177	1	73
α-helix	182	1
β-strand	183	1	73
α-helix	184	1
β-strand	185-186	2	9
β-strand	192-202	11	9
α-helix	209	1
α-helix	213-215	3
β-strand	216-222	7	9
β-strand	234-243	10	9
α-helix	244-247	4
β-strand	251-252	2	74
β-strand	255-256	2	75
β-strand	258-266	9	9
α-helix	269-271	3
α-helix	273-274	2
α-helix	278-290	13
α-helix	295-302	8
α-helix	311-322	12
β-strand	327-328	2	76
β-strand	334-335	2	76
β-strand	341-345	5	77
α-helix	351-361	11
β-strand	365-369	5	77
α-helix	375-377	3
β-strand	381-384	4	78
β-strand	391-394	4	78
α-helix	397-400	4
β-strand	404-409	6	77
α-helix	416-428	13
β-strand	430-435	6	79
β-strand	438-443	6	79
β-strand	446-452	7	77
α-helix	465-468	4
α-helix	473-477	5
β-strand	481-485	5	77
α-helix	491-506	16
α-helix	525-528	4
α-helix	530-531	2
β-strand	548-549	2	80
α-helix	550-551	2
β-strand	562-563	2	80
α-helix	565-577	13
α-helix	580	1
β-strand	581-582	2	81
α-helix	583	1
α-helix	584-598	15
α-helix	600-602	3
β-strand	607-609	3	82
α-helix	615-632	18
β-strand	636-637	2	81
α-helix	639-653	15
β-strand	654-656	3	82
α-helix	657-658	2

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2, A	protein	904	Homo sapiens	P49736 (AlphaFold model)
DNA replication licensing factor MCM3	3, B	protein	810	Homo sapiens	P25205 (AlphaFold model)
DNA replication licensing factor MCM4	4, C	protein	866	Homo sapiens	P33991 (AlphaFold model)
DNA replication licensing factor MCM5	5, D	protein	734	Homo sapiens	P33992 (AlphaFold model)
DNA replication licensing factor MCM6	6, E	protein	821	Homo sapiens	Q14566
DNA replication licensing factor MCM7	7, F	protein	719	Homo sapiens	P33993
DNA (47-mer)	O	DNA	47	Saccharomyces cerevisiae
DNA (47-mer)	S	DNA	47	Saccharomyces cerevisiae

Sequence of entity 1 (2, A), FASTA

>8W0F_1 DNA replication licensing factor MCM2 (chains 2, A)
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF

Sequence of entity 2 (3, B), FASTA

>8W0F_2 DNA replication licensing factor MCM3 (chains 3, B)
SNAAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKN
EKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTS
CFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKD
EENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVV
GTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQ
LAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYV
LCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMD
RTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSR
FDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQED
QQDTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLR
SQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVL
EKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMP
QVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEE
PFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Sequence of entity 3 (4, C), FASTA

>8W0F_3 DNA replication licensing factor MCM4 (chains 4, C)
SNAMSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGV
DLQSPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPD
LGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPL
AKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTF
DMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIP
EMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQES
PEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHID
VIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIK
KGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKG
SSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLS
IAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEA
YDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDM
RKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPR
TGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITK
DMFEEALRALADDDFLTVTGKTVRLL

Sequence of entity 4 (5, D), FASTA

>8W0F_4 DNA replication licensing factor MCM5 (chains 5, D)
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK

Sequence of entity 5 (6, E), FASTA

>8W0F_5 DNA replication licensing factor MCM6 (chains 6, E)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 6 (7, F), FASTA

>8W0F_6 DNA replication licensing factor MCM7 (chains 7, F)
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Sequence of entity 7 (O), FASTA

>8W0F_7 DNA (47-MER) (chains O)
AAAAAAAAAAAAAAAAAAAAAAATTTTTTTTTTTTTTTTTTTTTTTT

Sequence of entity 8 (S), FASTA

>8W0F_8 DNA (47-MER) (chains S)
AAAAAAAAAAAAAAAAAAAAAAAATTTTTTTTTTTTTTTTTTTTTTT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	8
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	10

Primary citation

Multiple mechanisms for licensing human replication origins. Yang, R., Hunker, O., Wise, M. et al. Nature (2024) 636:488-498. DOI 10.1038/s41586-024-08237-8 · PubMed

Other PDB entries of the same protein (UniProt P49736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YA7 1.67 Å, Cdc7-Dbf4 bound to an Mcm2-S40 derived bivalent substrate
7CIZ 1.8 Å, Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
5BNX 2.31 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5JA4 2.42 Å, Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
7CJ0 2.5 Å, Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD
7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
5BNV 2.79 Å, Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
4UUZ 2.9 Å, MCM2-histone complex
5BO0 2.91 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer
8S09 3.1 Å, H. sapiens MCM2-7 double hexamer bound to double stranded DNA

Browse structure collections

About this viewer

MolViewer shows 8W0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.