8WJG: URAT1(R477S)

Cryo-EM structure of URAT1(R477S). Determined by electron microscopy at 3.0 Å resolution. Released 28 Aug 2024.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,952
Mol. weight: 58.03 kDa
Released: 28 Aug 2024

Explore 8WJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WJG contains 32 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	15-41	27
β-strand	47-49	3	1
α-helix	52-55	4
α-helix	57-61	5
α-helix	69-76	8
β-strand	79	1	2
α-helix	81-83	3
β-strand	85	1	2
α-helix	86	1
β-strand	90-91	2	3
α-helix	96-99	4
α-helix	110-112	3
β-strand	113-114	2	3
β-strand	120-122	3	1
β-strand	129	1	4
α-helix	131-135	5
α-helix	139-141	3
α-helix	144-170	27
α-helix	172-191	20
α-helix	196-224	29
α-helix	230-254	25
β-strand	257	1	4
α-helix	258-266	9
α-helix	268-276	9
α-helix	280-281	2
α-helix	283-288	6
α-helix	292-305	14
α-helix	309-312	4
α-helix	317-328	12
α-helix	337-342	6
α-helix	344-367	24
α-helix	371-374	4
α-helix	378-402	25
α-helix	405-425	21
α-helix	433-459	27
α-helix	462-489	28
α-helix	496-512	17
α-helix	522-524	3
α-helix	527-537	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 22 member 12	A	protein	538	Homo sapiens	Q96S37 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WJG_1 Solute carrier family 22 member 12 (chains A)
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQ
ASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGW
VYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY
LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLG
FSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW
RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAF
GFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI
LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAASGGA
ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKA

Primary citation

Structural basis for the transport and substrate selection of human urate transporter 1. He, J., Liu, G., Kong, F. et al. Cell Rep (2024) 43:114628-114628. DOI 10.1016/j.celrep.2024.114628 · PubMed

Other PDB entries of the same protein (UniProt Q96S37 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9DKC 2.55 Å, Structure of URAT1 in complex with TD-3
9DK9 2.68 Å, Structure of URAT1 with no external ligand added
9B1G 2.7 Å, Human urate transporter 1 URAT1 in complex with dotinurad
9DKB 2.74 Å, Structure of URAT1 in complex with lesinurad
9B1F 2.9 Å, Human urate transporter 1 URAT1 in apo state
9B1H 2.9 Å, Human urate transporter 1 URAT1 in complex with lesinurad
9B1J 3.0 Å, Urate bound human URAT1 in the inward-facing state
9B1M 3.0 Å, Pyrazinoate bound human URAT1 in the inward-facing state (site1)
9DKA 3.0 Å, Structure of URAT1 in complex with benzbromarone

Browse structure collections

About this viewer

MolViewer shows 8WJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.