9B1G: Human urate transporter 1 URAT1

Human urate transporter 1 URAT1 in complex with dotinurad. Determined by electron microscopy at 2.7 Å resolution. Released 18 Sept 2024.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,958
Mol. weight: 59.84 kDa
Ligands: A1AIK, NAG
Released: 18 Sept 2024

Explore 9B1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B1G contains 33 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	15-36	22
α-helix	38-41	4
β-strand	47-49	3	1
α-helix	52-55	4
α-helix	60-61	2
α-helix	66-73	8
β-strand	76	1	2
β-strand	82	1	2
β-strand	86-88	3	3
α-helix	93-96	4
α-helix	102-104	3
α-helix	107-109	3
β-strand	110-112	3	3
β-strand	117-119	3	1
β-strand	126	1	4
α-helix	128-132	5
α-helix	136-138	3
α-helix	141-167	27
α-helix	169-188	20
α-helix	193-220	28
α-helix	227-251	25
β-strand	254	1	4
α-helix	255-263	9
α-helix	265-272	8
α-helix	277-279	3
α-helix	280-285	6
α-helix	289-303	15
α-helix	307-309	3
α-helix	313-319	7
α-helix	321-326	6
α-helix	333-338	6
α-helix	340-363	24
α-helix	364-369	6
α-helix	374-398	25
α-helix	401-421	21
α-helix	427-454	28
α-helix	458-481	24
α-helix	482-488	7
α-helix	491-508	18
α-helix	512-513	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 22 member 12	A	protein	547	Homo sapiens	Q96S37 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9B1G_1 Solute carrier family 22 member 12 (chains A)
FSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAVST
SLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRS
IFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAV
MGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGH
GLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLPESARWLIIKGKPDQALQELRKVARI
NGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPGLRFRTCISTLCWFAFGFTFFG
LALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCILANTLV
PHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLV
RLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNS
VLKSTQF

Ligands and cofactors

ID	Name	Formula	Copies
A1AIK	dotinurad	C14 H9 Cl2 N O4 S	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Transport mechanism and structural pharmacology of human urate transporter URAT1. Dai, Y., Lee, C.H. Cell Res (2024) 34:776-787. DOI 10.1038/s41422-024-01023-1 · PubMed

Other PDB entries of the same protein (UniProt Q96S37 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9DKC 2.55 Å, Structure of URAT1 in complex with TD-3
9DK9 2.68 Å, Structure of URAT1 with no external ligand added
9DKB 2.74 Å, Structure of URAT1 in complex with lesinurad
9B1F 2.9 Å, Human urate transporter 1 URAT1 in apo state
9B1H 2.9 Å, Human urate transporter 1 URAT1 in complex with lesinurad
8WJG 3.0 Å, Cryo-EM structure of URAT1(R477S)
9B1J 3.0 Å, Urate bound human URAT1 in the inward-facing state
9B1M 3.0 Å, Pyrazinoate bound human URAT1 in the inward-facing state (site1)
9DKA 3.0 Å, Structure of URAT1 in complex with benzbromarone

Browse structure collections

About this viewer

MolViewer shows 9B1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.