Human urate transporter 1 URAT1 in complex with lesinurad. Determined by electron microscopy at 2.9 Å resolution. Released 18 Sept 2024.
Explore 9B1H in 3D Show helices and sheets RCSB PDB PDBe
9B1H contains 33 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-10 | 7 | |
| α-helix | 15-36 | 22 | |
| α-helix | 37-39 | 3 | |
| β-strand | 47-49 | 3 | 1 |
| α-helix | 52-55 | 4 | |
| α-helix | 66-73 | 8 | |
| β-strand | 76 | 1 | 2 |
| β-strand | 82 | 1 | 2 |
| β-strand | 86-88 | 3 | 3 |
| α-helix | 93-95 | 3 | |
| α-helix | 107-109 | 3 | |
| β-strand | 110-112 | 3 | 3 |
| β-strand | 117-119 | 3 | 1 |
| β-strand | 126 | 1 | 4 |
| α-helix | 128-132 | 5 | |
| α-helix | 136-138 | 3 | |
| α-helix | 141-167 | 27 | |
| α-helix | 169-188 | 20 | |
| α-helix | 193-219 | 27 | |
| α-helix | 227-251 | 25 | |
| β-strand | 254 | 1 | 4 |
| α-helix | 255-263 | 9 | |
| α-helix | 265-272 | 8 | |
| α-helix | 277-279 | 3 | |
| α-helix | 280-285 | 6 | |
| α-helix | 289-303 | 15 | |
| α-helix | 306-310 | 5 | |
| α-helix | 314-317 | 4 | |
| α-helix | 321-328 | 8 | |
| α-helix | 333-338 | 6 | |
| α-helix | 340-363 | 24 | |
| α-helix | 367-369 | 3 | |
| α-helix | 374-383 | 10 | |
| α-helix | 385-398 | 14 | |
| α-helix | 401-421 | 21 | |
| α-helix | 427-455 | 29 | |
| α-helix | 461-481 | 21 | |
| α-helix | 482-487 | 6 | |
| α-helix | 491-507 | 17 | |
| α-helix | 508-510 | 3 | |
| α-helix | 512-513 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Solute carrier family 22 member 12 | A | protein | 547 | Homo sapiens | Q96S37 (AlphaFold model) |
>9B1H_1 Solute carrier family 22 member 12 (chains A) FSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAVST SLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRS IFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAV MGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGH GLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLPESARWLIIKGKPDQALQELRKVARI NGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPGLRFRTCISTLCWFAFGFTFFG LALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCILANTLV PHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLV RLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNS VLKSTQF
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| A1AIL | lesinurad | C17 H14 Br N3 O2 S | 1 |
Transport mechanism and structural pharmacology of human urate transporter URAT1. Dai, Y., Lee, C.H. Cell Res (2024) 34:776-787. DOI 10.1038/s41422-024-01023-1 · PubMed
Other PDB entries of the same protein (UniProt Q96S37 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9B1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.