9DKB: URAT1

Structure of URAT1 in complex with lesinurad. Determined by electron microscopy at 2.74 Å resolution. Released 18 Jun 2025.

Method: Electron microscopy
Resolution: 2.74 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,828
Mol. weight: 55.78 kDa
Ligands: A1AIL
Released: 18 Jun 2025

Explore 9DKB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DKB contains 35 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	15-36	22
α-helix	38-41	4
β-strand	47-49	3	1
α-helix	52-55	4
α-helix	57-62	6
α-helix	69-74	6
β-strand	79-80	2	2
β-strand	84-85	2	2
β-strand	89-91	3	3
α-helix	96-99	4
α-helix	110-112	3
β-strand	113-115	3	3
α-helix	116	1
β-strand	120-122	3	1
α-helix	131-135	5
α-helix	139-141	3
α-helix	144-170	27
α-helix	173-190	18
α-helix	196-224	29
α-helix	227-229	3
α-helix	230-254	25
α-helix	259-266	8
α-helix	268-275	8
α-helix	276-278	3
α-helix	283-288	6
α-helix	293-305	13
α-helix	310-313	4
α-helix	317-329	13
α-helix	333-336	4
α-helix	337-339	3
α-helix	344-346	3
α-helix	347-367	21
α-helix	371-374	4
α-helix	378-402	25
α-helix	405-425	21
α-helix	432-459	28
α-helix	465-482	18
α-helix	484-490	7
α-helix	495-511	17
α-helix	516-517	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
URAT1	A	protein	518	Homo sapiens	Q96S37 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9DKB_1 URAT1 (chains A)
MAFSELLDQVGGLGRFQVLQTVALVVPIMWLCTQSMLENFSAAVPSHRCWVPLLDNSTAQ
ASVPGALGPEALLAVSIPPGPNQGPHQCRRFRQPQWQLLDPNATATNWSEAATEPCVDGW
VYDRSTFTSTIVAKWDLVCDSQALKPMAQSIYLAGILVGAAVCGPASDRFGRRLVLTWSY
LQMAVSGTAAAFAPTFPVYCLFRFLVAFAVAGVMMNTGTLVMEWTSAQARPLVMTLNSLG
FSFGHVLMAAVAYGVRDWALLQLVVSVPFFLCFVYSCWLAESARWLLITGRLDRGLRELQ
RVAAINGKRAVGDTLTPQVLLSAMQEELSVGQAPASLGTLLRTPGLRLRTCISTLCWFAF
GFTFFGLALDLQALGSNIFLLQVLIGVVDIPAKIGTLLLLSRLGRRPTQAASLVLAGLCI
LANTLVPHEMGALRSALAVLGLGGLGAAFTCITIYSGELFPTVLRMTAVGLGQMAARGGA
ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPET

Ligands and cofactors

ID	Name	Formula	Copies
A1AIL	lesinurad	C17 H14 Br N3 O2 S	1

Primary citation

Molecular basis of the urate transporter URAT1 inhibition by gout drugs. Suo, Y., Fedor, J.G., Zhang, H. et al. Nat Commun (2025) 16:5178-5178. DOI 10.1038/s41467-025-60480-3 · PubMed

Other PDB entries of the same protein (UniProt Q96S37 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9DKC 2.55 Å, Structure of URAT1 in complex with TD-3
9DK9 2.68 Å, Structure of URAT1 with no external ligand added
9B1G 2.7 Å, Human urate transporter 1 URAT1 in complex with dotinurad
9B1F 2.9 Å, Human urate transporter 1 URAT1 in apo state
9B1H 2.9 Å, Human urate transporter 1 URAT1 in complex with lesinurad
8WJG 3.0 Å, Cryo-EM structure of URAT1(R477S)
9B1J 3.0 Å, Urate bound human URAT1 in the inward-facing state
9B1M 3.0 Å, Pyrazinoate bound human URAT1 in the inward-facing state (site1)
9DKA 3.0 Å, Structure of URAT1 in complex with benzbromarone

Browse structure collections

About this viewer

MolViewer shows 9DKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.