The Crystal Structure of TGF beta R2 kinase domain from Biortus. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Mar 2024.
Explore 8YGZ in 3D Show helices and sheets RCSB PDB PDBe
8YGZ contains 19 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 245-252 | 8 | 1 |
| β-strand | 257-262 | 6 | 1 |
| β-strand | 274-280 | 7 | 1 |
| α-helix | 281-283 | 3 | |
| α-helix | 284-295 | 12 | |
| α-helix | 297-299 | 3 | |
| β-strand | 304 | 1 | 2 |
| α-helix | 305-306 | 2 | |
| β-strand | 307-314 | 8 | 1 |
| β-strand | 319-325 | 7 | 1 |
| β-strand | 332 | 1 | 2 |
| α-helix | 333-339 | 7 | |
| β-strand | 342 | 1 | 3 |
| α-helix | 344-362 | 19 | |
| β-strand | 365 | 1 | 4 |
| β-strand | 371 | 1 | 4 |
| β-strand | 375-376 | 2 | 5 |
| α-helix | 382-384 | 3 | |
| β-strand | 385-387 | 3 | 2 |
| β-strand | 393-395 | 3 | 2 |
| β-strand | 402-403 | 2 | 5 |
| α-helix | 422-424 | 3 | |
| α-helix | 427-430 | 4 | |
| α-helix | 440-459 | 20 | |
| β-strand | 461 | 1 | 3 |
| α-helix | 462-464 | 3 | |
| α-helix | 468-470 | 3 | |
| α-helix | 484-488 | 5 | |
| α-helix | 489-493 | 5 | |
| α-helix | 502-506 | 5 | |
| α-helix | 508-520 | 13 | |
| α-helix | 525-527 | 3 | |
| α-helix | 529-530 | 2 | |
| α-helix | 531-539 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-2 | A | protein | 314 | Homo sapiens | P37173 (AlphaFold model) |
>8YGZ_1 TGF-beta receptor type-2 (chains A) GHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFS DINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLA RGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLAN SGQVGTARYMAPEVLASAMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFG SKVREHPCVASMADNVLADAGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVA ERFSELEHLDRLSG
The Crystal Structure of TGF beta R2 kinase domain from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.
Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8YGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.