Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment and ADP ribose. Determined by X-ray diffraction at 1.96 Å resolution. Released 9 Oct 2024.
Explore 8Z57 in 3D Show helices and sheets RCSB PDB PDBe
8Z57 contains 20 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 37 | 1 | 1 |
| α-helix | 40-49 | 10 | |
| β-strand | 52-57 | 6 | 1 |
| α-helix | 59-63 | 5 | |
| α-helix | 82-85 | 4 | |
| α-helix | 88-93 | 6 | |
| α-helix | 95-108 | 14 | |
| α-helix | 109-111 | 3 | |
| α-helix | 116-130 | 15 | |
| β-strand | 134-139 | 6 | 1 |
| α-helix | 145-149 | 5 | |
| β-strand | 154-156 | 3 | 1 |
| β-strand | 159-166 | 8 | 2 |
| β-strand | 172-174 | 3 | 2 |
| α-helix | 182-184 | 3 | |
| α-helix | 194-196 | 3 | |
| α-helix | 201-203 | 3 | |
| β-strand | 206 | 1 | 3 |
| α-helix | 214 | 1 | |
| β-strand | 215 | 1 | 3 |
| β-strand | 216-220 | 5 | 2 |
| α-helix | 221-222 | 2 | |
| α-helix | 225 | 1 | |
| β-strand | 226 | 1 | 4 |
| α-helix | 227-228 | 2 | |
| α-helix | 229-241 | 13 | |
| β-strand | 244-248 | 5 | 1 |
| α-helix | 257-259 | 3 | |
| α-helix | 260-266 | 7 | |
| β-strand | 271-275 | 5 | 1 |
| α-helix | 282-284 | 3 | |
| β-strand | 287-290 | 4 | 1 |
| α-helix | 293-301 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 121 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacylase sirtuin-5, mitochondrial | A | protein | 274 | Homo sapiens | Q9NXA8 (AlphaFold model) |
| Peroxiredoxin-1 fragment | B | protein | 9 | Homo sapiens | Q06830 (AlphaFold model) |
>8Z57_1 NAD-dependent protein deacylase sirtuin-5, mitochondrial (chains A) MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATP LAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRK AGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCE EAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARG VPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>8Z57_2 Peroxiredoxin-1 fragment (chains B) SKEYFSXQK
SIRT5 mutants reveal the role of conserved asparagine and glutamine residues in the NAD + -binding pocket. Yokoyama, T., Takayama, Y., Mizuguchi, M. et al. FEBS Lett (2024) 598:2269-2280. DOI 10.1002/1873-3468.14961 · PubMed
Other PDB entries of the same protein (UniProt Q9NXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Z57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.