8ZRT: Endothelin receptor type B

Cryo-EM structure focused on the receptor of the ET-1 bound ETBR-DNGI complex. Determined by electron microscopy at 3.62 Å resolution. Released 2 Oct 2024.

Method: Electron microscopy
Resolution: 3.62 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,322
Mol. weight: 41.31 kDa
Released: 2 Oct 2024

Explore 8ZRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZRT contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7

Chain R: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	98-127	30
α-helix	135-163	29
α-helix	171-204	34
α-helix	216-237	22
β-strand	240-243	4	1
β-strand	246-247	2	2
β-strand	250-251	2	2
β-strand	254-257	4	1
α-helix	264-271	8
α-helix	273-278	6
α-helix	279-283	5
α-helix	284-300	17
α-helix	319-348	30
α-helix	357-387	31
α-helix	391-398	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin receptor type B	R	protein	346	Homo sapiens	P24530 (AlphaFold model)
Endothelin-1	L	protein	21	Homo sapiens	P05305 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>8ZRT_1 Endothelin receptor type B (chains R)
PGGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNST
LLYIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQ
KASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFD
IITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEML
RKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELL
SFLLVLDYIGINMASLNSCINPIALYLVSKRFKNAFKSALCCWAQS

Sequence of entity 2 (L), FASTA

>8ZRT_2 Endothelin-1 (chains L)
CSCSSLMDKECVYFCHLDIIW

Primary citation

Structure of endothelin ET B receptor-G i complex in a conformation stabilized by unique NPxxL motif. Tani, K., Maki-Yonekura, S., Kanno, R. et al. Commun Biol (2024) 7:1303-1303. DOI 10.1038/s42003-024-06905-z · PubMed

Other PDB entries of the same protein (UniProt P24530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IGK 2.0 Å, Crystal Structure of human ETB receptor in complex with Endothelin-3
5X93 2.2 Å, Human endothelin receptor type-B in complex with antagonist K-8794
5GLI 2.5 Å, Human endothelin receptor type-B in the ligand-free form
6IGL 2.7 Å, Crystal Structure of human ETB receptor in complex with IRL1620
6K1Q 2.7 Å, Human endothelin receptor type-B in complex with inverse agonist IRL2500
5GLH 2.8 Å, Human endothelin receptor type-B in complex with ET-1
8IY5 2.8 Å, ETB-Gi complex bound to endothelin-1
8HBD 2.99 Å, Cryo-EM structure of IRL1620-bound ETBR-Gi complex
6LRY 3.0 Å, Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b
8XVE 3.0 Å, Cryo-EM structure of ETBR bound with BQ3020
8IY6 3.13 Å, ETB-Gi complex bound to Endotheline-1, focused on receptor
8XGR 3.2 Å, ETB-eGt complex bound to endothelin-1

Browse structure collections

About this viewer

MolViewer shows 8ZRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.