9B5Z: GluA2 flip Q
GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of LBD-TMD-TARPgamma2. Determined by electron microscopy at 2.71 Å resolution. Released 31 Jul 2024.
- Method
- Electron microscopy
- Resolution
- 2.71 Å
- Organisms
- Mus musculus, Rattus norvegicus
- Chains
- 8
- Atoms
- 18,680
- Mol. weight
- 542.22 kDa
- Released
- 31 Jul 2024
Explore 9B5Z in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9B5Z contains 113 α-helices and 103 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 22 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-399 | 5 | 19 |
| β-strand | 402 | 1 | 20 |
| β-strand | 406 | 1 | 20 |
| β-strand | 407 | 1 | 21 |
| α-helix | 417-420 | 4 | |
| β-strand | 422 | 1 | 21 |
| α-helix | 424-436 | 13 | |
| β-strand | 440-444 | 5 | 19 |
| β-strand | 453-454 | 2 | 22 |
| β-strand | 459-460 | 2 | 22 |
| α-helix | 462-468 | 7 | |
| β-strand | 474 | 1 | 19 |
| β-strand | 475 | 1 | 23 |
| β-strand | 480 | 1 | 24 |
| α-helix | 483-486 | 4 | |
| β-strand | 489-491 | 3 | 23 |
| β-strand | 496-498 | 3 | 24 |
| β-strand | 500-505 | 6 | 25 |
| α-helix | 506-508 | 3 | |
| α-helix | 511-513 | 3 | |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 18 |
| α-helix | 523-545 | 23 | |
| α-helix | 548-550 | 3 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-629 | 34 | |
| α-helix | 636-641 | 6 | |
| β-strand | 646-648 | 3 | 25 |
| β-strand | 650 | 1 | 26 |
| α-helix | 654-660 | 7 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 26 |
| α-helix | 686-695 | 10 | |
| β-strand | 700-705 | 6 | 25 |
| α-helix | 706-713 | 8 | |
| β-strand | 720-723 | 4 | 25 |
| β-strand | 730-732 | 3 | 24 |
| β-strand | 735-737 | 3 | 23 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-764 | 7 | |
| α-helix | 765-769 | 5 | |
| β-strand | 787 | 1 | 27 |
| α-helix | 788 | 1 | |
| α-helix | 789-791 | 3 | |
| α-helix | 793-824 | 32 | |
Chain B: 25 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 394-399 | 6 | 11 |
| β-strand | 402 | 1 | 12 |
| β-strand | 406 | 1 | 12 |
| β-strand | 407-408 | 2 | 13 |
| α-helix | 417-420 | 4 | |
| β-strand | 421-422 | 2 | 13 |
| α-helix | 424-436 | 13 | |
| β-strand | 439-444 | 6 | 11 |
| β-strand | 453 | 1 | 14 |
| β-strand | 460 | 1 | 14 |
| α-helix | 462-468 | 7 | |
| β-strand | 474-475 | 2 | 11 |
| α-helix | 479 | 1 | |
| β-strand | 480 | 1 | 15 |
| α-helix | 481 | 1 | |
| α-helix | 483-486 | 4 | |
| β-strand | 490-491 | 2 | 11 |
| β-strand | 496-498 | 3 | 15 |
| β-strand | 500-505 | 6 | 16 |
| α-helix | 506-507 | 2 | |
| α-helix | 510-513 | 4 | |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 10 |
| α-helix | 523-545 | 23 | |
| α-helix | 548-550 | 3 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-625 | 30 | |
| α-helix | 636-641 | 6 | |
| β-strand | 646-648 | 3 | 16 |
| β-strand | 650 | 1 | 17 |
| α-helix | 654-660 | 7 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 17 |
| α-helix | 686-694 | 9 | |
| β-strand | 700-705 | 6 | 16 |
| α-helix | 706-713 | 8 | |
| β-strand | 720-723 | 4 | 16 |
| β-strand | 730-732 | 3 | 15 |
| β-strand | 735-736 | 2 | 11 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-764 | 7 | |
| α-helix | 765-769 | 5 | |
| α-helix | 785-786 | 2 | |
| β-strand | 787 | 1 | 18 |
| α-helix | 788 | 1 | |
| α-helix | 789-791 | 3 | |
| α-helix | 793-824 | 32 | |
Chain C: 21 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 394 | 1 | |
| β-strand | 395-399 | 5 | 3 |
| β-strand | 402 | 1 | 4 |
| β-strand | 406 | 1 | 4 |
| β-strand | 407-408 | 2 | 5 |
| α-helix | 418-420 | 3 | |
| β-strand | 421-422 | 2 | 5 |
| α-helix | 424-436 | 13 | |
| β-strand | 440-444 | 5 | 3 |
| β-strand | 454 | 1 | 6 |
| β-strand | 459 | 1 | 6 |
| α-helix | 462-468 | 7 | |
| β-strand | 474-480 | 7 | 3 |
| α-helix | 483-486 | 4 | |
| β-strand | 489-491 | 3 | 3 |
| β-strand | 496-498 | 3 | 3 |
| β-strand | 500-505 | 6 | 7 |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 8 |
| α-helix | 523-545 | 23 | |
| α-helix | 548-550 | 3 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-629 | 34 | |
| α-helix | 636-641 | 6 | |
| β-strand | 646-648 | 3 | 7 |
| β-strand | 650 | 1 | 9 |
| α-helix | 654-661 | 8 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 9 |
| α-helix | 686-695 | 10 | |
| β-strand | 700-705 | 6 | 7 |
| α-helix | 706-713 | 8 | |
| β-strand | 720-723 | 4 | 7 |
| β-strand | 730-737 | 8 | 3 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-764 | 7 | |
| α-helix | 765-769 | 5 | |
| β-strand | 787 | 1 | 10 |
| α-helix | 788 | 1 | |
| α-helix | 789-792 | 4 | |
| α-helix | 793-824 | 32 | |
Chain D: 23 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 396-399 | 4 | 28 |
| β-strand | 407-408 | 2 | 29 |
| α-helix | 417-420 | 4 | |
| β-strand | 421-422 | 2 | 29 |
| α-helix | 424-436 | 13 | |
| β-strand | 441-444 | 4 | 28 |
| β-strand | 453 | 1 | 30 |
| β-strand | 460 | 1 | 30 |
| α-helix | 462-468 | 7 | |
| β-strand | 474-480 | 7 | 28 |
| α-helix | 483-486 | 4 | |
| β-strand | 489-491 | 3 | 28 |
| β-strand | 496-498 | 3 | 28 |
| β-strand | 500-505 | 6 | 31 |
| α-helix | 506-507 | 2 | |
| α-helix | 510-513 | 4 | |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 27 |
| α-helix | 523-545 | 23 | |
| α-helix | 548-550 | 3 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-625 | 30 | |
| α-helix | 636-641 | 6 | |
| β-strand | 646-648 | 3 | 31 |
| β-strand | 650 | 1 | 32 |
| α-helix | 654-661 | 8 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 32 |
| α-helix | 686-694 | 9 | |
| β-strand | 700-705 | 6 | 31 |
| α-helix | 706-713 | 8 | |
| β-strand | 720-723 | 4 | 31 |
| β-strand | 730-737 | 8 | 28 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-764 | 7 | |
| α-helix | 765-769 | 5 | |
| α-helix | 785-786 | 2 | |
| β-strand | 787 | 1 | 8 |
| α-helix | 788 | 1 | |
| α-helix | 789-791 | 3 | |
| α-helix | 793-824 | 32 | |
Chain E: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-28 | 22 | |
| β-strand | 34-38 | 5 | 33 |
| β-strand | 57-61 | 5 | 33 |
| β-strand | 65-68 | 4 | 33 |
| β-strand | 77-79 | 3 | 33 |
| α-helix | 93-104 | 12 | |
| α-helix | 106-126 | 21 | |
| α-helix | 133-160 | 28 | |
| β-strand | 175-176 | 2 | 33 |
| α-helix | 178-213 | 36 | |
Chain F: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-29 | 24 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 56-61 | 6 | 2 |
| β-strand | 65-68 | 4 | 2 |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 80-81 | 2 | |
| α-helix | 93-104 | 12 | |
| α-helix | 106-127 | 22 | |
| α-helix | 133-160 | 28 | |
| α-helix | 164-166 | 3 | |
| β-strand | 175-176 | 2 | 2 |
| α-helix | 178-213 | 36 | |
Chain G: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-29 | 23 | |
| β-strand | 34-38 | 5 | 34 |
| β-strand | 57-61 | 5 | 34 |
| β-strand | 65-68 | 4 | 34 |
| β-strand | 77-79 | 3 | 34 |
| α-helix | 93-104 | 12 | |
| α-helix | 106-124 | 19 | |
| α-helix | 133-160 | 28 | |
| β-strand | 174-176 | 3 | 34 |
| α-helix | 178-213 | 36 | |
Chain H: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-29 | 24 | |
| β-strand | 34-38 | 5 | 1 |
| β-strand | 57-61 | 5 | 1 |
| β-strand | 65-68 | 4 | 1 |
| β-strand | 77-79 | 3 | 1 |
| α-helix | 93-104 | 12 | |
| α-helix | 106-127 | 22 | |
| α-helix | 133-162 | 30 | |
| β-strand | 175-176 | 2 | 1 |
| α-helix | 178-213 | 36 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Voltage-dependent calcium channel gamma-2 subunit | E, F, G, H | protein | 323 | Mus musculus | O88602 (AlphaFold model) |
| Isoform Flip of Glutamate receptor 2 | A, B, C, D | protein | 889 | Rattus norvegicus | P19491 (AlphaFold model) |
Sequence of entity 1 (E, F, G, H), FASTA
>9B5Z_1 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV
Sequence of entity 2 (A, B, C, D), FASTA
>9B5Z_2 Isoform Flip of Glutamate receptor 2 (chains A, B, C, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYDIATPKGSSLGTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSSQNSQNFATDYKDDDDKEGYNVYGIESVKI
Primary citation
Proton-triggered rearrangement of the AMPA receptor N-terminal domains impacts receptor kinetics and synaptic localization. Ivica, J., Kejzar, N., Ho, H. et al. Nat Struct Mol Biol (2024) 31:1601-1613. DOI 10.1038/s41594-024-01369-5 · PubMed
Other PDB entries of the same protein (UniProt O88602 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3JXT 1.5 Å, Crystal structure of the third PDZ domain of SAP-102 in complex with a fluorogenic…
- 8FQF 2.29 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
- 8VHV 2.3 Å, Transmembrane AMPA Receptor Regulatory Protein Subunit Gamma 2
- 8FPG 2.32 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
- 8FQ5 2.34 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
- 8FQB 2.36 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
- 8FPS 2.38 Å, GluA2 flip Q isoform N619K mutant of AMPA receptor in complex with gain-of-function TARP…
- 8FP4 2.4 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
- 4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
- 8FP9 2.44 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
- 9B60 2.57 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of TMD-TARPgamma2
- 9B63 2.76 Å, GluA2 flip Q in complex with TARPgamma2 at pH5, consensus structure of TMD-TARPgamma2
Browse structure collections
About this viewer
MolViewer shows 9B5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.