9B6A: GluA2 flip Q

GluA2 flip Q in complex with TARPgamma2 at pH8, class12, structure of LBD-TMD-TARPgamma2. Determined by electron microscopy at 3.35 Å resolution. Released 31 Jul 2024.

Method: Electron microscopy
Resolution: 3.35 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 8
Atoms: 18,493
Mol. weight: 542.22 kDa
Released: 31 Jul 2024

Explore 9B6A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B6A contains 104 α-helices and 100 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	395-399	5	19
β-strand	402	1	20
β-strand	406	1	20
β-strand	407-408	2	21
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	21
α-helix	424-436	13
β-strand	440-444	5	19
β-strand	452-453	2	22
β-strand	460-461	2	22
α-helix	463-468	6
β-strand	474-475	2	19
β-strand	480	1	23
α-helix	483-486	4
β-strand	489-491	3	19
β-strand	496-498	3	23
β-strand	500-505	6	24
α-helix	516-518	3
β-strand	521	1	18
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-628	33
α-helix	636-641	6
β-strand	646-648	3	24
β-strand	650	1	25
α-helix	654-660	7
α-helix	665-676	12
β-strand	683	1	25
α-helix	686-695	10
β-strand	700-705	6	24
α-helix	706-713	8
β-strand	720-723	4	24
β-strand	730-732	3	23
β-strand	735-737	3	19
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
β-strand	787	1	26
α-helix	788	1
α-helix	793-824	32

Chain B: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	395-399	5	12
β-strand	407-408	2	13
α-helix	417-420	4
β-strand	421-422	2	13
α-helix	424-436	13
β-strand	440-444	5	12
β-strand	453	1	14
β-strand	460	1	14
α-helix	462-468	7
β-strand	474	1	12
β-strand	475-480	6	15
α-helix	483-488	6
β-strand	490-491	2	15
β-strand	496-498	3	15
β-strand	500-505	6	16
α-helix	509-513	5
α-helix	516-518	3
β-strand	521	1	11
α-helix	523-545	23
α-helix	573-584	12
α-helix	596-625	30
α-helix	636-641	6
β-strand	646-648	3	16
β-strand	650	1	17
α-helix	654-660	7
α-helix	665-675	11
β-strand	683	1	17
α-helix	686-694	9
β-strand	700-705	6	16
α-helix	706-713	8
β-strand	720-723	4	16
β-strand	730-736	7	15
α-helix	743-756	14
α-helix	758-764	7
α-helix	765-769	5
α-helix	786	1
β-strand	787	1	18
α-helix	788	1
α-helix	789-791	3
α-helix	793-824	32

Chain C: 19 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	395-399	5	3
β-strand	402	1	4
β-strand	406	1	4
β-strand	407-408	2	5
α-helix	417-420	4
β-strand	421-422	2	5
α-helix	424-436	13
β-strand	440-444	5	3
β-strand	454	1	6
β-strand	459	1	6
α-helix	462-468	7
β-strand	474-475	2	3
β-strand	480	1	7
α-helix	483-486	4
β-strand	489-491	3	3
β-strand	496-498	3	7
β-strand	500-505	6	8
α-helix	516-518	3
β-strand	521	1	9
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-628	33
α-helix	636-641	6
β-strand	646-648	3	8
β-strand	650	1	10
α-helix	654-660	7
α-helix	665-675	11
β-strand	683	1	10
α-helix	686-695	10
β-strand	700-705	6	8
α-helix	706-713	8
β-strand	720-723	4	8
β-strand	730-732	3	7
β-strand	735-737	3	3
α-helix	743-756	14
α-helix	758-764	7
α-helix	765-769	5
β-strand	787	1	11
α-helix	788	1
α-helix	793-824	32

Chain D: 22 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	394-399	6	27
β-strand	407-408	2	28
α-helix	417-420	4
β-strand	421-422	2	28
α-helix	424-436	13
β-strand	439-444	6	27
α-helix	462-468	7
β-strand	474	1	27
β-strand	475	1	29
β-strand	480	1	29
α-helix	483-488	6
β-strand	489-498	10	29
β-strand	500-504	5	30
α-helix	510-513	4
α-helix	516-518	3
β-strand	521	1	26
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-625	30
α-helix	636-641	6
β-strand	646-648	3	30
β-strand	650	1	31
α-helix	654-660	7
α-helix	665-675	11
β-strand	683	1	31
α-helix	686-695	10
β-strand	700-705	6	30
α-helix	706-713	8
β-strand	721-723	3	30
β-strand	730-737	8	29
α-helix	743-756	14
α-helix	758-764	7
α-helix	765-769	5
α-helix	785-786	2
β-strand	787	1	9
α-helix	788	1
α-helix	789-791	3
α-helix	793-824	32

Chain E: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-39	6	32
β-strand	56-61	6	32
β-strand	65-68	4	32
β-strand	78-79	2	32
α-helix	80	1
α-helix	93-104	12
α-helix	106-124	19
α-helix	133-160	28
β-strand	174-176	3	32
α-helix	178-213	36

Chain F: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-29	24
β-strand	34-38	5	2
β-strand	57-61	5	2
β-strand	65-68	4	2
β-strand	77-79	3	2
α-helix	80-81	2
α-helix	93-104	12
α-helix	106-125	20
α-helix	133-159	27
β-strand	175-176	2	2
α-helix	178-213	36

Chain G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-38	5	33
β-strand	57-61	5	33
β-strand	65-68	4	33
β-strand	77-79	3	33
α-helix	93-104	12
α-helix	106-125	20
α-helix	133-160	28
β-strand	174-176	3	33
α-helix	178-213	36

Chain H: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-29	24
β-strand	34-38	5	1
β-strand	57-61	5	1
β-strand	65-68	4	1
β-strand	77-79	3	1
α-helix	93-104	12
α-helix	106-127	22
α-helix	133-159	27
β-strand	174-176	3	1
α-helix	178-213	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent calcium channel gamma-2 subunit	E, F, G, H	protein	323	Mus musculus	O88602 (AlphaFold model)
Isoform Flip of Glutamate receptor 2	A, B, C, D	protein	889	Rattus norvegicus	P19491 (AlphaFold model)

Sequence of entity 1 (E, F, G, H), FASTA

>9B6A_1 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV

Sequence of entity 2 (A, B, C, D), FASTA

>9B6A_2 Isoform Flip of Glutamate receptor 2 (chains A, B, C, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYDIATPKGSSLGTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSSQNSQNFATDYKDDDDKEGYNVYGIESVKI

Primary citation

Proton-triggered rearrangement of the AMPA receptor N-terminal domains impacts receptor kinetics and synaptic localization. Ivica, J., Kejzar, N., Ho, H. et al. Nat Struct Mol Biol (2024) 31:1601-1613. DOI 10.1038/s41594-024-01369-5 · PubMed

Other PDB entries of the same protein (UniProt O88602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JXT 1.5 Å, Crystal structure of the third PDZ domain of SAP-102 in complex with a fluorogenic…
8FQF 2.29 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8VHV 2.3 Å, Transmembrane AMPA Receptor Regulatory Protein Subunit Gamma 2
8FPG 2.32 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8FQ5 2.34 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FQB 2.36 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FPS 2.38 Å, GluA2 flip Q isoform N619K mutant of AMPA receptor in complex with gain-of-function TARP…
8FP4 2.4 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
8FP9 2.44 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
9B60 2.57 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of TMD-TARPgamma2
9B5Z 2.71 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of LBD-TMD-TARPgamma2

Browse structure collections

About this viewer

MolViewer shows 9B6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.