9BEE: Alpha-crystallin B chain

alphaB-crystallin N-terminal IXI variant in a fibril state. Determined by electron microscopy at 3.4 Å resolution. Released 11 Dec 2024.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,545
Mol. weight: 22.05 kDa
Released: 11 Dec 2024

Explore 9BEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BEE contains 1 α-helix and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	1
β-strand	67-70	4	3
β-strand	74-79	6	3
α-helix	86-88	3
β-strand	89-92	4	2
β-strand	98-108	11	2
β-strand	113-122	10	2
β-strand	128	1	4
β-strand	134-138	5	3
β-strand	142-148	7	3
β-strand	149	1	4

Chain B: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	77-80	4	1
β-strand	90-94	5	2
β-strand	97-103	7	2
β-strand	108-109	2	2
β-strand	112-123	12	2
β-strand	134-137	4	1
β-strand	142-146	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	B	protein	88	Homo sapiens	P02511 (AlphaFold model)
Alpha-crystallin B chain	A	protein	108	Homo sapiens	P02511 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9BEE_1 Alpha-crystallin B chain (chains B)
SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITS
SLSSDGVLTVNGPRKQVSGPERTIPITR

Sequence of entity 2 (A), FASTA

>9BEE_2 Alpha-crystallin B chain (chains A)
XXXXXXXTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFIS
REFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITR

Primary citation

Dynamic fibrillar assembly of alpha B-crystallin induced by perturbation of the conserved NT-IXI motif resolved by cryo-EM. McFarland, R., Noroozi, R., Miller, A.P. et al. Nat Commun (2024) 15:10336-10336. DOI 10.1038/s41467-024-54647-7 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
2Y1Z 2.5 Å, Human alphaB Crystallin ACD R120G
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
2WJ7 2.63 Å, human alphaB crystallin
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase

Browse structure collections

About this viewer

MolViewer shows 9BEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.