Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta Type II Receptor Extracellular Domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 22 Jan 2025.
Explore 9E9G in 3D Show helices and sheets RCSB PDB PDBe
9E9G contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 46-48 | 3 | |
| β-strand | 50-52 | 3 | 1 |
| β-strand | 55-58 | 4 | 2 |
| β-strand | 66-68 | 3 | 3 |
| β-strand | 74-76 | 3 | 1 |
| β-strand | 83-90 | 8 | 2 |
| β-strand | 95-102 | 8 | 2 |
| β-strand | 108 | 1 | 4 |
| β-strand | 111 | 1 | 4 |
| β-strand | 121-122 | 2 | 3 |
| β-strand | 124-126 | 3 | 2 |
| β-strand | 132-138 | 7 | 2 |
| α-helix | 143-145 | 3 | |
| β-strand | 146-148 | 3 | 3 |
| α-helix | 151-153 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18 | 1 | 5 |
| α-helix | 19-22 | 4 | |
| β-strand | 24 | 1 | 6 |
| β-strand | 27-33 | 7 | 6 |
| β-strand | 44 | 1 | 6 |
| α-helix | 45 | 1 | |
| β-strand | 53 | 1 | 5 |
| α-helix | 54 | 1 | |
| β-strand | 57-63 | 7 | 6 |
| β-strand | 74-81 | 8 | 6 |
| β-strand | 88-92 | 5 | 6 |
| α-helix | 96-101 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-2 | A | protein | 118 | Homo sapiens | P37173 (AlphaFold model) |
| Transforming growth factor beta mimic 6 | B | protein | 92 | Heligmosomoides polygyrus | A0A2P1IQ80 (AlphaFold model) |
>9E9G_1 TGF-beta receptor type-2 (chains A) MVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENIT LETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYN
>9E9G_2 Transforming growth factor beta mimic 6 (chains B) GSGTGSSCPPLPDDETVWYEYYGYVDGRHTVGDAAIKDSLENYPPNTHARRHCKALSKKA DPGEFVAICYQRRGTSESQWQYYPRIASCPDP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CAC | Cacodylate ion | C2 H6 As O2 | 2 |
Water and common crystallization additives (NA, CL, GOL) are not listed.
TGM6 is a helminth secretory product that mimics TGF-beta binding to TGFBR2 to antagonize signaling in fibroblasts. White, S.E., Schwartze, T.A., Mukundan, A. et al. Nat Commun (2025) 16:1847-1847. DOI 10.1038/s41467-025-56954-z · PubMed
Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9E9G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.