9FA7: Integrator complex subunit 15

Name: PDB 9FA7: Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3)
Published: 2024-06-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3). Determined by electron microscopy at 4.0 Å resolution. Released 12 Jun 2024.

Method: Electron microscopy
Resolution: 4.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 14,712
Mol. weight: 270.31 kDa
Released: 12 Jun 2024

Explore 9FA7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FA7 contains 104 α-helices and 63 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	4
α-helix	18-21	4
β-strand	23	1	5
β-strand	28	1	6
α-helix	42-46	5
β-strand	47	1	6
β-strand	50	1	5
α-helix	51-69	19
β-strand	75-81	7	4
β-strand	85-87	3	4
α-helix	98-108	11
α-helix	111-112	2
α-helix	117-119	3
α-helix	123-133	11
α-helix	138-146	9
β-strand	158-163	6	4
β-strand	164	1	7
α-helix	169-192	24
α-helix	197-199	3
β-strand	202-205	4	4
β-strand	208	1	7
β-strand	224-227	4	4
β-strand	230-232	3	4
α-helix	241-254	14
β-strand	257-260	4	8
β-strand	263	1	9
β-strand	283-286	4	8
α-helix	287-290	4
β-strand	314	1	8
β-strand	317-319	3	9
β-strand	331	1	10
β-strand	334-336	3	9
β-strand	337-339	3	8
α-helix	345-355	11
β-strand	360-364	5	9
β-strand	372-379	8	9
β-strand	384-387	4	9
α-helix	393-394	2
α-helix	399-401	3
β-strand	413	1	11
α-helix	415-424	10
β-strand	426	1	12
β-strand	427-429	3	13
β-strand	435	1	14
β-strand	441	1	14
α-helix	444-455	12
β-strand	462	1	11
α-helix	463-465	3
α-helix	475-481	7
α-helix	488-507	20
α-helix	525-542	18
α-helix	544-546	3
α-helix	548-560	13

Chain B: 22 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	15
β-strand	7-8	2	15
α-helix	11-14	4
β-strand	16-17	2	16
β-strand	25-26	2	16
α-helix	27-44	18
β-strand	51-56	6	15
β-strand	61-67	7	15
α-helix	70-76	7
α-helix	88-102	15
β-strand	109-114	6	15
α-helix	126-136	11
β-strand	150-154	5	15
β-strand	155	1	17
α-helix	161-167	7
α-helix	170-177	8
β-strand	183	1	15
β-strand	186	1	17
α-helix	194-207	14
β-strand	212-218	7	18
β-strand	221-228	8	18
α-helix	230-233	4
β-strand	234	1	19
β-strand	245	1	19
β-strand	250-255	6	18
β-strand	256	1	12
β-strand	258	1	20
α-helix	259-262	4
β-strand	266	1	10
β-strand	267	1	21
β-strand	271-275	5	18
α-helix	298	1
α-helix	299-303	5
α-helix	310-320	11
β-strand	322	1	20
β-strand	325-329	5	18
β-strand	332-336	5	18
β-strand	349-352	4	18
β-strand	353	1	21
α-helix	354	1
α-helix	361-363	3
α-helix	366-368	3
β-strand	369-371	3	13
α-helix	389	1
α-helix	391-393	3
α-helix	409-424	16
α-helix	430-447	18
α-helix	450-465	16
α-helix	473-489	17

Chain C: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	13-34	22
α-helix	38-41	4
α-helix	42-51	10
α-helix	68-84	17
α-helix	88-99	12
α-helix	107-124	18
α-helix	127-138	12
β-strand	141	1	1
α-helix	142-154	13
α-helix	155-159	5
α-helix	164-168	5
α-helix	169-172	4
α-helix	175-188	14
α-helix	198-199	2
α-helix	200-212	13
α-helix	214-218	5
α-helix	219-223	5
α-helix	229-231	3
β-strand	234	1	1
α-helix	235-236	2
α-helix	240-256	17
α-helix	277-307	31
α-helix	319-321	3
α-helix	322-335	14
α-helix	342-361	20
α-helix	369-375	7
α-helix	380-381	2
α-helix	383-390	8

Chain D: 32 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-35	14
α-helix	40-51	12
α-helix	57-69	13
α-helix	74-87	14
α-helix	95-105	11
α-helix	108-121	14
α-helix	125-138	14
α-helix	140-142	3
α-helix	143-160	18
α-helix	169-173	5
α-helix	174-178	5
α-helix	179-183	5
α-helix	194-211	18
α-helix	255-271	17
α-helix	283-295	13
α-helix	304-328	25
β-strand	345-347	3	2
β-strand	397	1	3
α-helix	406-425	20
α-helix	427-440	14
α-helix	447-459	13
α-helix	463-475	13
α-helix	491-504	14
α-helix	511-522	12
β-strand	551	1	3
β-strand	552-554	3	2
α-helix	557-576	20
α-helix	584-592	9
α-helix	601-614	14
α-helix	622-625	4
α-helix	629-640	12
α-helix	655-659	5
α-helix	668-685	18
α-helix	690-700	11
α-helix	705-708	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 15	C	protein	449	Homo sapiens	Q96N11 (AlphaFold model)
Integrator complex subunit 10	D	protein	710	Homo sapiens	Q9NVR2 (AlphaFold model)
Integrator complex subunit 13	A	protein	706	Homo sapiens	Q9NVM9 (AlphaFold model)
Integrator complex subunit 14	B	protein	518	Homo sapiens	Q96SY0 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9FA7_1 Integrator complex subunit 15 (chains C)
MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERS
AQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM
AVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQ
FITSVTALYDLSSDDLIPPMDLLEMIVTWIFEDPRLILITFLNTPIAANLPIGFLELTPL
VGLIRWCVKAPLAYKRKKKPPLSNGHVSNKVTKDPGVGMDRDSHLLYSKLHLSVLQVLMT
LQLHLTEKNLYGRLGLILFDHMVPLVEEINRLADELNPLNASQEIELSLDRLAQALQVAM
ASGALLCTRDDLRTLCSRLPHNNLLQLVISGPVQQSPHAALPPGFYPHIHTPPLGYGAVP
AHPAAHPALPTHPGHTFISGVTFPFRPIR

Sequence of entity 2 (D), FASTA

>9FA7_2 Integrator complex subunit 10 (chains D)
MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAG
RLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTE
QCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLP
LIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQIENQHQGAQDTSDLMSPSKRSSQKY
IIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDILHRMKDLCRYMNNFDS
EAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEI
DRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESW
ELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSIS
QPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKV
KPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRG
ENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKH
HTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT

Sequence of entity 3 (A), FASTA

>9FA7_3 Integrator complex subunit 13 (chains A)
MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSM
EYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECC
SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAG
RHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH
LGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSV
LLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASV
IVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLV
RAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDS
ERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNR
INTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ

Sequence of entity 4 (B), FASTA

>9FA7_4 Integrator complex subunit 14 (chains B)
MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLW
ELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLG
IGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNN
GEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEI
DPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPL
PWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKIL
RNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLT
HAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI

Primary citation

Structural basis of the Integrator complex assembly and association with transcription factors. Razew, M., Fraudeau, A., Pfleiderer, M.M. et al. Mol Cell (2024) 84:2542. DOI 10.1016/j.molcel.2024.05.009 · PubMed

Other PDB entries of the same protein (UniProt Q96N11 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RC4 3.1 Å, Structure of Integrator-PP2A complex
9EP4 3.2 Å, Structure of Integrator subcomplex INTS5/8/15
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
9EP1 4.0 Å, Structure of the Integrator arm module containing INTS10/13/14/15 subunits (state 2)
9FA4 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 1)
8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…
9EOF 7.7 Å, Structure of the human INTS5/8/10/15 subcomplex

Browse structure collections

About this viewer

MolViewer shows 9FA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.