9G0D: Human Mical1 bMERB_V978A domain:Rab10 complex

Structure of human Mical1 bMERB_V978A domain:Rab10 complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 2 Jul 2025.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,641
Mol. weight: 38.57 kDa
Ligands: MG, GNP
Released: 2 Jul 2025

Explore 9G0D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9G0D contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	919-958	40
α-helix	964-1015	52
α-helix	1019-1021	3
α-helix	1024-1059	36

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
α-helix	22-31	10
β-strand	44-53	10	1
β-strand	56-65	10	1
α-helix	69-71	3
α-helix	72-76	5
β-strand	84-90	7	1
α-helix	94-98	5
α-helix	100-110	11
β-strand	116-122	7	1
α-helix	127-129	3
α-helix	134-144	11
β-strand	147-150	4	1
β-strand	152	1	2
β-strand	157	1	2
α-helix	159-172	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
[F-actin]-monooxygenase MICAL1	B	protein	153	Homo sapiens	Q8TDZ2 (AlphaFold model)
Ras-related protein Rab-10	C	protein	177	Homo sapiens	P61026 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9G0D_1 [F-actin]-monooxygenase MICAL1 (chains B)
GHMKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQL
LQLADKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVL
RKLVDLVNQRDALIRFQEERRLSELALGTGAQG

Sequence of entity 2 (C), FASTA

>9G0D_2 Ras-related protein Rab-10 (chains C)
GHMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKI
KLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERM
LLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1

Primary citation

Biochemical and structural insights into the auto-inhibited state of Mical1 and its activation by Rab8. Rai, A., Janning, P., Vetter, I.R. et al. Elife (2024). DOI 10.7554/elife.102375.1

Other PDB entries of the same protein (UniProt Q8TDZ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HLO 1.17 Å, Crystal structure of ASAP1-SH3 and MICAL1-PRM complex
6KU0 1.6 Å, Crystal structure of MyoVa-GTD in complex with MICAL1-GTBM
9G0C 1.8 Å, Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex.
5LPN 2.8 Å, Structure of human Rab10 in complex with the bMERB domain of Mical-1
9EWY 3.1 Å, CryoEM structure of human MICAL1
5LE0 3.3 Å, MICAL1 Cterminal domain
8Y6K 3.94 Å, Cryo-EM structure of full-length MICAL1 in the autoinhibited state
1WYL Solution structure of the CH domain of human NEDD9 interacting protein with calponin…
2CO8 Solution structures of the LIM domain of human NEDD9 interacting protein with calponin…
2DK9 Solution structure of Calponin Homology domain of Human MICAL-1

Browse structure collections

About this viewer

MolViewer shows 9G0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.