9GKG: UNC119

Crystal structure of UNC119 in complex with Squarunkin A. Determined by X-ray diffraction at 2.21 Å resolution. Released 15 Jan 2025.

Method: X-ray diffraction
Resolution: 2.21 Å
Organism: Homo sapiens
Chains: 6
Atoms: 8,663
Mol. weight: 129.58 kDa
Ligands: LRX
Released: 15 Jan 2025

Explore 9GKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GKG contains 38 α-helices and 64 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	4
β-strand	101-106	6	4
β-strand	128-132	5	5
α-helix	135-139	5
β-strand	142-150	9	4
β-strand	156	1	6
β-strand	159-167	9	5
β-strand	170-178	9	5
α-helix	181	1
β-strand	182	1	6
α-helix	183	1
β-strand	187-195	9	4
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	5
β-strand	225-235	11	5

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	7
β-strand	101-106	6	7
β-strand	128-132	5	8
α-helix	135-139	5
β-strand	142-150	9	7
β-strand	156	1	9
β-strand	160-167	8	8
β-strand	170-178	9	8
β-strand	182	1	9
β-strand	187-195	9	7
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	8
β-strand	225-235	11	8

Chains C, D and E: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	10
β-strand	101-106	6	10
β-strand	128-132	5	11
α-helix	135-139	5
β-strand	142-150	9	10
β-strand	156	1	12
β-strand	160-167	8	11
β-strand	170-178	9	11
α-helix	181	1
β-strand	182	1	12
α-helix	183	1
β-strand	187-195	9	10
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	11
β-strand	225-235	11	11

Chain K: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	16
β-strand	101-106	6	16
β-strand	128-132	5	17
α-helix	135-139	5
β-strand	142-150	9	16
β-strand	160-167	8	17
β-strand	170-178	9	17
β-strand	187-195	9	16
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	17
β-strand	225-235	11	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-119 homolog A	A, B, C, D, E, K	protein	182	Homo sapiens	Q13432 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, K), FASTA

>9GKG_1 Protein unc-119 homolog A (chains A, B, C, D, E, K)
PIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINR
RDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFH
FGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG
TP

Ligands and cofactors

ID	Name	Formula	Copies
LRX	squarunkin A	C25 H32 F3 N5 O4	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

UNC119 regulates T-cell receptor signalling in primary T cells and T acute lymphocytic leukaemia. Samarakoon, Y., Yelland, T., Garcia-Gonzalez, E. et al. Life Sci Alliance (2025) 8. DOI 10.26508/lsa.202403066 · PubMed

Other PDB entries of the same protein (UniProt Q13432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GQQ 1.95 Å, Crystal structure of the human retinal protein 4 (unc-119 homolog A). Northeast…
3RBQ 2.0 Å, Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha…
6H6A 2.0 Å, Crystal structure of UNC119 in complex with LCK peptide
4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
5L7K 2.1 Å, The crystal structure of myristoylated NPHP3 peptide in complex with UNC119a
7UMO 2.3 Å, Structure of Unc119-inhibitor complex.
9NEM 2.49 Å, Structure of Unc119-Farnesylated peptide complex
4GOK 2.6 Å, The Crystal structure of Arl2GppNHp in complex with UNC119a

Browse structure collections

About this viewer

MolViewer shows 9GKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.