9GLQ: P73 tetramerisation domain

Crystal structure of p73 tetramerisation domain in complex with darpins 1800. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jan 2025.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 1,752
Mol. weight: 25.49 kDa
Ligands: CO
Released: 22 Jan 2025

Explore 9GLQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GLQ contains 13 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	362-378	17
α-helix	383-396	14

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	362-377	16
α-helix	378-380	3
α-helix	383-393	11

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	17-25	9
α-helix	40-46	7
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-125	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A, B	protein	50	Homo sapiens	O15350 (AlphaFold model)
Darpins 1800	C	protein	126	synthetic construct

Sequence of entity 1 (A, B), FASTA

>9GLQ_1 Tumor protein p73 (chains A, B)
GSDEDTYYLQVRGRKNFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR

Sequence of entity 2 (C), FASTA

>9GLQ_2 Darpins 1800 (chains C)
GSDLGKKLLEAAAVGQDDEVRILMANGADVNAMDQNGETPLHLAAMNGHLEIVEVLLKTG
ADVNASDFHGDTPLHLAAMAGHLEIVEVLLKHGADVNAQDTWGYIPFDLAAWAGNEDIAE
VLQKAA

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

DARPins as a novel tool to detect and degrade p73. Munick, P., Zielinski, J., Strubel, A. et al. Cell Death Dis (2024) 15:909-909. DOI 10.1038/s41419-024-07304-2 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 9GLQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.