9GNB: P73 SAM domain

Structure of p73 SAM domain in complex with DARPin B9. Determined by X-ray diffraction at 1.8 Å resolution. Released 18 Dec 2024.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,721
Mol. weight: 24.13 kDa
Released: 18 Dec 2024

Explore 9GNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GNB contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-14	10
α-helix	17-19	3
α-helix	20-24	5
α-helix	31-34	4
α-helix	39-44	6
α-helix	49-61	13

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	17-25	9
α-helix	40-46	7
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	107-114	8
α-helix	117-125	9
α-helix	140-146	7
α-helix	150-158	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A	protein	64	Homo sapiens	O15350 (AlphaFold model)
Darpin B9	B	protein	160	synthetic construct

Sequence of entity 1 (A), FASTA

>9GNB_1 Tumor protein p73 (chains A)
GSADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQ
DLKQ

Sequence of entity 2 (B), FASTA

>9GNB_2 Darpin B9 (chains B)
GSDLGKKLLEAARAGQDDEVRILMANGADVNALDSWGFTPLHLAAFFGHLEIVEVLLKTG
ADVNAVDNAGTTPLHLAAHAGHLEIVEVLLKAGADVNAHDQHGTVTPLHLAAHMGHLEIV
EVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA

Primary citation

DARPins as a novel tool to detect and degrade p73. Munick, P., Zielinski, J., Strubel, A. et al. Cell Death Dis (2024) 15:909-909. DOI 10.1038/s41419-024-07304-2 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 9GNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.