9GW5: Interferon alpha-2

type-I interferon autoantibodies pmab3, pmab19 and pmab14 in complex with Interferon alpha-2. Determined by X-ray diffraction at 4.0 Å resolution. Released 8 Oct 2025.

Method: X-ray diffraction
Resolution: 4.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,368
Mol. weight: 111.84 kDa
Released: 8 Oct 2025

Explore 9GW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GW5 contains 31 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-21	12
α-helix	26-32	7
α-helix	40-43	4
α-helix	46-48	3
α-helix	53-67	15
α-helix	70-75	6
α-helix	78-100	23
α-helix	113-132	20
α-helix	137-154	18

Chain H: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	13	1	2
β-strand	20-27	8	1
α-helix	31-33	3
β-strand	36-41	6	3
β-strand	48-53	6	3
β-strand	60-62	3	3
β-strand	70-75	6	1
β-strand	80-85	6	1
α-helix	90-92	3
β-strand	94-101	8	3
β-strand	111-114	4	3
β-strand	118-120	3	3
β-strand	121	1	2
β-strand	438-441	4	4
β-strand	444-447	4	5
β-strand	453-459	7	4
β-strand	467-472	6	5
β-strand	479-483	5	5
β-strand	487-488	2	5
α-helix	489	1
β-strand	496-501	6	4
β-strand	504-509	6	4
α-helix	514-516	3
β-strand	519-524	6	5
α-helix	530	1
β-strand	531-532	2	5
β-strand	536-540	5	5

Chain U: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	6
β-strand	12-14	3	7
β-strand	20-27	8	6
α-helix	31-33	3
β-strand	36-42	7	7
β-strand	47-53	7	7
β-strand	60-62	3	7
α-helix	64-66	3
β-strand	70-75	6	6
β-strand	80-85	6	6
α-helix	90-92	3
β-strand	94-100	7	7
β-strand	112	1	7
β-strand	116-120	5	7
α-helix	144-145	2
β-strand	146-149	4	8
β-strand	152-155	4	9
α-helix	156	1
β-strand	161-167	7	8
β-strand	175-180	6	9
β-strand	186-191	6	9
β-strand	195-196	2	9
α-helix	197	1
β-strand	204-209	6	8
β-strand	212-217	6	8
α-helix	222-224	3
β-strand	227-232	6	9
α-helix	238	1
β-strand	240	1	9
β-strand	244-248	5	9

Chain V: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	10
α-helix	9-11	3
β-strand	12-14	3	11
β-strand	20-27	8	10
α-helix	31-33	3
β-strand	35-41	7	11
β-strand	47-54	8	11
β-strand	60-62	3	11
α-helix	64-66	3
β-strand	70-75	6	10
β-strand	80-85	6	10
α-helix	90-92	3
β-strand	94-100	7	11
α-helix	103-105	3
β-strand	108	1	11
β-strand	112-116	5	11
β-strand	143-145	3	12
β-strand	148-149	2	13
β-strand	157-167	11	12
α-helix	168	1
α-helix	169-171	3
β-strand	172-177	6	13
β-strand	183-188	6	13
β-strand	192-193	2	13
α-helix	194	1
β-strand	204-214	11	12
α-helix	219-221	3
β-strand	224-229	6	13
β-strand	237	1	13
β-strand	241-243	3	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon alpha-2	A	protein	188	Homo sapiens	P01563 (AlphaFold model)
type-I interferons autoantibody pamb14 heavy chain	H	protein	290	Homo sapiens
scFv type-I interferons autoantibody pamb03	U	protein	288	Homo sapiens
scFv type-I interferons autoantibody pamb19	V	protein	285	Homo sapiens

Sequence of entity 1 (A), FASTA

>9GW5_1 Interferon alpha-2 (chains A)
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSLVPRGSGGGS
HHHHHHHH

Sequence of entity 2 (H), FASTA

>9GW5_2 type-I interferons autoantibody pamb14 heavy chain (chains H)
RSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSHAMSWVRQPPGKGLEWVSSISAAGGST
YYAASVKGRFTISRDNSNKTLYLQMNSLRAEDTAIYYCAKESDRVTTLDWFDPWGQGTLV
TVSSGTGGSGGGGSGGGGSGGGASDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWY
QQKPGQAPKLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYITPL
TFGGGTKVEIKGPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 3 (U), FASTA

>9GW5_3 scFv type-I interferons autoantibody pamb03 (chains U)
RSQVQLVQSGAEVKKPGASVKVSCKTSGYTFTSYDINWVRQATGQGLEWMGWMNPNTGNT
GYAQKFQGRVAMTRSSSTRTAYMELSSLTSEDTAVYYCARAGLTGAGLDDYWGQGTLVTV
SSGTGGSGGGGSGGGGSGGGASDIQMTQSPSSLSASVGDRVTITCQASQDIRKYLNWYQQ
KPGKAPKLLIYDASNLQTGVPSRFSGSGSGTDFTLTISRLQPEDIATYYCQQYGDLPLTF
GGGTKVGITGPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 4 (V), FASTA

>9GW5_4 scFv type-I interferons autoantibody pamb19 (chains V)
RSQVQLVQSGAEVKKPGASVKVSCKASGYDFSRFSIHWVRQAPGQRLEWMGWLITGNGDA
KYSQKFQGRVTISRNISASTAYMEVTNLRSEDSAVYYCSRDPVAAGLWGQGTLVTVSSGT
GGSGGGGSGGGGSGGGASEILLTQSPGTLSLSPGERATLSCRASQFVSSTYLAWYQHKPG
QAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTINGLEPEDFAVYYCQQYGSSPRTFGQG
TKVEIKGPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Primary citation

Temporal and structural insights into type-I interferons autoantibodies in severe COVID-19. Vanderkerken, M., Fournier, M., Dorgham, K. et al. To be published.

Other PDB entries of the same protein (UniProt P01563 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GVO 1.81 Å, type-I interferons autoantibodies pmab15 and pmab14 in complex with Interferon alpha-2
3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
9GVL 2.01 Å, type-I interferons autoantibody pmab15 in complex with Interferon alpha-2
1RH2 2.9 Å, Recombinant human interferon-alpha 2B
4YPG 3.0 Å, Structural Insights Into the Neutralization Properties of a Human Anti-Interferon…
4Z5R 3.0 Å, Rontalizumab Fab bound to Interferon-a2
3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
1ITF Interferon alpha-2A, NMR, 24 structures
2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…
2LAG Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of…
2LMS A single GalNAc residue on Threonine-106 modifies the dynamics and the structure of…

Browse structure collections

About this viewer

MolViewer shows 9GW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.