9HUB: D11 mAbs
D11 mAbs bound to alpha-Bungarotoxin at pH 7.5. Determined by X-ray diffraction at 1.33 Å resolution. Released 19 Nov 2025.
- Method
- X-ray diffraction
- Resolution
- 1.33 Å
- Organisms
- Homo sapiens, Bungarus multicinctus
- Chains
- 6
- Atoms
- 6,089
- Mol. weight
- 77.55 kDa
- Released
- 19 Nov 2025
Explore 9HUB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9HUB contains 22 α-helices and 61 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain B: 3 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 13 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 14 |
| β-strand | 18-24 | 7 | 13 |
| β-strand | 34-39 | 6 | 14 |
| β-strand | 45-52 | 8 | 14 |
| β-strand | 57-60 | 4 | 14 |
| β-strand | 65 | 1 | 13 |
| β-strand | 68-73 | 6 | 13 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 13 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 14 |
| β-strand | 104-105 | 2 | 5 |
| β-strand | 108-110 | 3 | 5 |
| β-strand | 118-121 | 4 | 14 |
| β-strand | 125-129 | 5 | 14 |
Chain C: 3 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 146-149 | 4 | |
| β-strand | 150-151 | 2 | 1 |
| β-strand | 155-158 | 4 | 2 |
| β-strand | 164-170 | 7 | 1 |
| α-helix | 175-177 | 3 | |
| β-strand | 181-185 | 5 | 2 |
| β-strand | 192-195 | 4 | 2 |
| β-strand | 196 | 1 | 3 |
| β-strand | 200 | 1 | 3 |
| β-strand | 209-214 | 6 | 1 |
| β-strand | 219-224 | 6 | 1 |
| α-helix | 229-231 | 3 | |
| β-strand | 233-241 | 9 | 2 |
| β-strand | 246-249 | 4 | 2 |
| β-strand | 253-257 | 5 | 2 |
Chain I: 4 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 8 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 9 |
| β-strand | 18-25 | 8 | 8 |
| β-strand | 34-39 | 6 | 9 |
| β-strand | 45-52 | 8 | 9 |
| α-helix | 53-55 | 3 | |
| β-strand | 57-60 | 4 | 9 |
| β-strand | 68-73 | 6 | 8 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 8 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 9 |
| β-strand | 104-105 | 2 | 7 |
| β-strand | 108-110 | 3 | 7 |
| β-strand | 118-121 | 4 | 9 |
| β-strand | 125-129 | 5 | 9 |
Chain M: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 146-149 | 4 | |
| β-strand | 150-151 | 2 | 10 |
| β-strand | 155-158 | 4 | 11 |
| β-strand | 164-170 | 7 | 10 |
| α-helix | 175-177 | 3 | |
| β-strand | 181-185 | 5 | 11 |
| β-strand | 192-195 | 4 | 11 |
| β-strand | 196 | 1 | 12 |
| β-strand | 200 | 1 | 12 |
| β-strand | 209-214 | 6 | 10 |
| α-helix | 215-217 | 3 | |
| β-strand | 219-224 | 6 | 10 |
| α-helix | 229-231 | 3 | |
| β-strand | 233-241 | 9 | 11 |
| β-strand | 246-249 | 4 | 11 |
| β-strand | 253-257 | 5 | 11 |
Chain X: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 4 |
| β-strand | 12-15 | 4 | 4 |
| α-helix | 16-17 | 2 | |
| β-strand | 22-28 | 7 | 5 |
| α-helix | 33-36 | 4 | |
| β-strand | 39-45 | 7 | 5 |
| α-helix | 48-50 | 3 | |
| β-strand | 56-60 | 5 | 5 |
| α-helix | 69-71 | 3 | |
Chain Z: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 6 |
| β-strand | 12-15 | 4 | 6 |
| α-helix | 16-17 | 2 | |
| β-strand | 22-28 | 7 | 7 |
| α-helix | 33-36 | 4 | |
| β-strand | 39-45 | 7 | 7 |
| α-helix | 48-52 | 5 | |
| β-strand | 55-60 | 6 | 7 |
| α-helix | 69-71 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| heavy chain | C, M | protein | 121 | Homo sapiens | |
| Alpha-bungarotoxin | X, Z | protein | 95 | Bungarus multicinctus | P60615 (AlphaFold model) |
| light chain | B, I | protein | 144 | Homo sapiens | |
Sequence of entity 1 (C, M), FASTA
>9HUB_1 heavy chain (chains C, M)
GASNFMLTQPRSVSESPGKTVTISCTRSSGSIGSDYVHWYQQRPGSSPTTVIYEDNQRPS
GVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDRSNHEVVFGGGTKLTVLENLYF
Q
Sequence of entity 2 (X, Z), FASTA
>9HUB_2 Alpha-bungarotoxin (chains X, Z)
MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKV
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Sequence of entity 3 (B, I), FASTA
>9HUB_3 light chain (chains B, I)
AQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTAN
YAQKFQGRVTITADESTSTAYMELRSLRSDDTAVYYCARDNLGYCSGGSCYSDYYYYYMD
VWGQGTLVTVSSGGGGSGGGGSGG
Primary citation
Rational design of antibodies with pH-dependent antigen-binding properties using structural insights from broadly neutralizing antibodies against alpha-neurotoxins. Wade, J., Strancar, N., Fernandez-Quintero, M.L. et al. MAbs (2025) 17:2553624-2553624. DOI 10.1080/19420862.2025.2553624 · PubMed
Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
- 1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
- 8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
- 9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
- 2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
- 8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
- 6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
- 9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
- 1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
- 1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
- 1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
- 1HAJ A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
Browse structure collections
About this viewer
MolViewer shows 9HUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.