9I8A: Nuclear RNA export factor 1

NXT1-NXF1 complex crystallized in space group P65 2 2. Determined by X-ray diffraction at 1.5 Å resolution. Released 14 May 2025.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,755
Mol. weight: 36.82 kDa
Released: 14 May 2025

Explore 9I8A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I8A contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-30	25
α-helix	32-38	7
β-strand	39-47	9	2
β-strand	50-53	4	2
α-helix	55-64	10
α-helix	66-67	2
β-strand	68-79	12	2
α-helix	80-81	2
β-strand	90-101	12	2
β-strand	107-118	12	2
β-strand	125-135	11	2

Chain B: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	13	1	1
α-helix	17-34	18
α-helix	39-44	6
β-strand	46-55	10	1
α-helix	69-72	4
β-strand	75	1	1
α-helix	84-90	7
β-strand	92-93	2	1
α-helix	95-102	8
α-helix	106-107	2
β-strand	108-110	3	1
α-helix	112-114	3
β-strand	116-123	8	1
β-strand	126-137	12	1
β-strand	146-157	12	1
β-strand	163-174	12	1
α-helix	175-176	2
α-helix	177-184	8
α-helix	187-189	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear RNA export factor 1	B	protein	190	Homo sapiens	Q9UBU9 (AlphaFold model)
NTF2-related export protein 1	A	protein	138	Homo sapiens	Q9UKK6 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9I8A_1 Nuclear RNA export factor 1 (chains B)
APTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQ
NPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISA
QTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQ
RAFAMPAPTP

Sequence of entity 2 (A), FASTA

>9I8A_2 NTF2-related export protein 1 (chains A)
SVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFF
EMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPS
NTVWKIASDCFRFQDWAS

Primary citation

NXT1-NXF1 complex crystallized in space group P65 2 2. Koekemoer, L., Fairhead, M., Wright, N.D. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…
1KOO 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 9I8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.