9JF2: GABARAPL1

Crystal structure of GABARAPL1 in complex with ATG16L1. Determined by X-ray diffraction at 1.76 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,405
Mol. weight: 32.01 kDa
Released: 10 Sept 2025

Explore 9JF2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JF2 contains 15 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	240-242	3	4
α-helix	243	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	240-242	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A, B	protein	121	Homo sapiens	Q9H0R8 (AlphaFold model)
Autophagy-related protein 16-1	C, D	protein	13	Homo sapiens	Q676U5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9JF2_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A, B)
GPGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLT
VGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
K

Sequence of entity 2 (C, D), FASTA

>9JF2_2 Autophagy-related protein 16-1 (chains C, D)
EQDDDIEVIVDET

Primary citation

Molecular bases of the interactions of ATG16L1 with FIP200 and ATG8 family proteins. Gong, X., Zhou, Y., Wang, Y. et al. Nat Commun (2025) 16:9035-9035. DOI 10.1038/s41467-025-64097-4 · PubMed

Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YOO 1.06 Å, Structure of SAMM50 LIR bound to GABARAPL1
6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
6HOL 1.4 Å, Structure of ATG14 LIR motif bound to GABARAPL1
5LXI 1.44 Å, GABARAP-L1 ATG4B LIR Complex
7AA7 1.45 Å, Structure of SCOC pS12/pS18 LIR motif bound to GABARAPL1
8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1
5LXH 1.58 Å, GABARAP-L1 ATG4B LIR Complex
2R2Q 1.65 Å, Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1…
7AA9 1.72 Å, Structure of SCOC pT13/pT15 LIR motif bound to GABARAPL1
7JHX 1.91 Å, Crystal structure of hEPG5 LIR/GABARAPL1 complex
9HGC 2.52 Å, Crystal structure of human GABARAPL1 in complex with cyclic peptide GAB_D8
5DPT 2.9 Å, Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117

Browse structure collections

About this viewer

MolViewer shows 9JF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.