9KH4: Galectin-8 N-CRD with N-acetyllactosamine

Crystal structure of Galectin-8 N-CRD with N-acetyllactosamine. Determined by X-ray diffraction at 1.75 Å resolution. Released 12 Nov 2025.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,426
Mol. weight: 17.46 kDa
Ligands: RNQ, NI
Released: 12 Nov 2025

Explore 9KH4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KH4 contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	1
α-helix	22-23	2
β-strand	26-29	4	2
β-strand	39-45	7	1
β-strand	52-59	8	2
α-helix	67	1
β-strand	68-76	9	2
β-strand	82-89	8	2
β-strand	92-93	2	2
β-strand	97-99	3	2
β-strand	109-116	8	1
β-strand	120-125	6	1
β-strand	128-134	7	1
α-helix	139-141	3
β-strand	144-149	6	2
β-strand	152-159	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin-8	A	protein	150	Homo sapiens	O00214 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9KH4_1 Galectin-8 (chains A)
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVA
FHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHT
LLYGHRIGPEKIDTLGIYGKVNIHSIGFSF

Ligands and cofactors

ID	Name	Formula	Copies
RNQ	~{N}-[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-(hydroxymethyl)-5-[(2~{S},3~{R},4~{S},5…	C14 H25 N O11	1
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Galectin-8 binding to alpha-1 antitrypsin is a physiological mechanism in healthy individuals but exacerbates the symptoms of alpha-1 antitrypsin deficiency. Sayed, H., Mayo, K.H., Zhou, Y. et al. Arch Biochem Biophys (2025) 772:110577-110577. DOI 10.1016/j.abb.2025.110577 · PubMed

Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GZC 1.08 Å, Crystal structure of Galectin-8 N-CRD with part of linker
9FYJ 1.08 Å, N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand
5GZD 1.19 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
9FXZ 1.3 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with…
5GZE 1.32 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
3AP9 1.33 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
6Z6Y 1.34 Å, Galectin-8 N-terminal domain in complex with a sulfatide mimicking a sphingolipid
7ALS 1.35 Å, Alpha and beta Lactose isomer structure of Galectin 8, N-terminal domain
4BMB 1.35 Å, Crystal structure of the N terminal domain of human Galectin 8
31ML 1.5 Å, Crystal structure of the complex of galectin-8N-Methyl 2,6-anhydro-3-deoxy-3-S-(b-D-galac…
7P1M 1.52 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with benzimidazole…
3AP7 1.53 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…

Browse structure collections

About this viewer

MolViewer shows 9KH4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.