Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition mechanisms. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Jan 2026.
Explore 9LOA in 3D Show helices and sheets RCSB PDB PDBe
9LOA contains 6 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-27 | 16 | |
| β-strand | 33 | 1 | 1 |
| α-helix | 34-45 | 12 | |
| α-helix | 49-61 | 13 | |
| β-strand | 66-74 | 9 | 1 |
| β-strand | 77-86 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-27 | 17 | |
| α-helix | 34-45 | 12 | |
| α-helix | 49-62 | 14 | |
| β-strand | 66-74 | 9 | 2 |
| β-strand | 77-86 | 10 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A, B | protein | 87 | Homo sapiens | Q15326 (AlphaFold model) |
>9LOA_1 Zinc finger MYND domain-containing protein 11 (chains A, B) QADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVET LTVGCKGSKAGIEQEGYWLPGDEIDWE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Novel intermolecular zinc fingers and redox-driven conformational changes dictate tumor suppressor ZMYND11's role in cooperative recognition of diverse targets. Bai, X., Zhang, J., Wang, S. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag048 · PubMed
Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9LOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.