9LXP: Beta-arrestin-1

A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 2 conformation). Determined by electron microscopy at 3.2 Å resolution. Released 4 Mar 2026.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Homo sapiens, synthetic construct
Chains: 5
Atoms: 8,509
Mol. weight: 149.77 kDa
Released: 4 Mar 2026

Explore 9LXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LXP contains 39 α-helices and 79 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 13 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-43	7	1
α-helix	45-48	4
β-strand	52-62	11	4
α-helix	65	1
β-strand	76-85	10	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	123-125	3
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	139-140	2
β-strand	141	1	4
β-strand	144-151	8	4
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-188	6	5
α-helix	195-196	2
β-strand	197-203	7	5
β-strand	207-208	2	6
β-strand	214-221	8	5
β-strand	228	1	7
β-strand	230-231	2	8
β-strand	233-241	9	9
β-strand	247-249	3	9
β-strand	252-256	5	9
β-strand	262	1	7
β-strand	268-274	7	5
α-helix	279-281	3
β-strand	288-290	3	4
α-helix	291-292	2
β-strand	300	1	4
α-helix	301-303	3
β-strand	317-324	8	9
β-strand	327-328	2	8
β-strand	343	1	8
β-strand	346-349	4	9
β-strand	350-351	2	6
α-helix	362-364	3
β-strand	367	1	10

Chain C: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	11
β-strand	14-15	2	12
β-strand	20-28	9	11
β-strand	35-42	8	13
β-strand	48-55	8	13
β-strand	60-63	4	13
α-helix	65-67	3
β-strand	72-76	5	11
β-strand	81-87	7	11
α-helix	91-93	3
β-strand	95-97	3	14
β-strand	98-103	6	13
β-strand	112-113	2	13
α-helix	114-116	3
β-strand	117-119	3	14
β-strand	120-121	2	12
β-strand	130-133	4	15
β-strand	146-155	10	15
β-strand	161-164	4	16
α-helix	165-167	3
β-strand	173-175	3	15
α-helix	176-178	3
β-strand	179	1	15
β-strand	186-194	9	15
β-strand	206-210	5	16
β-strand	215-218	4	16

Chain E: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	17
β-strand	11-14	4	18
β-strand	20-26	7	17
β-strand	34-39	6	18
β-strand	46-50	5	18
β-strand	54-55	2	18
β-strand	57	1	19
β-strand	59	1	19
β-strand	64-68	5	17
β-strand	71-77	7	17
α-helix	81-83	3
β-strand	86-91	6	18
β-strand	94	1	10
β-strand	98-99	2	18
β-strand	103-107	5	18
β-strand	117-119	3	20
α-helix	120-122	3
α-helix	123-127	5
β-strand	130-136	7	20
β-strand	140	1	21
β-strand	147-151	5	22
β-strand	160-165	6	20
α-helix	166-168	3
β-strand	174	1	21
β-strand	175-183	9	20
α-helix	184-188	5
β-strand	192-197	6	22
β-strand	206-211	6	22

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-32	30

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	34-43	10
α-helix	174-178	5
α-helix	181-211	31
α-helix	218-244	27
α-helix	276-311	36
α-helix	321-325	5
α-helix	326-330	5
α-helix	331-346	16
α-helix	357-360	4
α-helix	361-387	27
β-strand	395	1	4
α-helix	402-417	16
α-helix	421-424	4
α-helix	435-456	22
α-helix	457-461	5
α-helix	464-472	9
β-strand	504-507	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	374	Homo sapiens	P49407 (AlphaFold model)
Fab30H	C	protein	230	synthetic construct
Fab30L	E	protein	215	synthetic construct
La-pth	L	protein	36	synthetic construct
Parathyroid hormone/parathyroid hormone-related peptide receptor	R	protein	482	Homo sapiens	Q03431 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9LXP_1 Beta-arrestin-1 (chains B)
MKGTRVFKKASCNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFR
YGREDLDVLGLTFRKDLFCANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPN
LPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQP
TAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADIC
LFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLCNNREKRGLALDGKLKHEDTNLAS
STLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPH
REVPENETPVDTNL

Sequence of entity 2 (C), FASTA

>9LXP_2 Fab30H (chains C)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYC
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT

Sequence of entity 3 (E), FASTA

>9LXP_3 Fab30L (chains E)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (L), FASTA

>9LXP_4 LA-PTH (chains L)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 5 (R), FASTA

>9LXP_5 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVT
NG

Primary citation

Structural basis of PTH1R-beta-arrestin core engagement reveals design principles for G-protein-biased therapeutics. Zhao, L.H., He, Q., Yuan, Q. et al. Nat Struct Mol Biol (2026) 33:868-881. DOI 10.1038/s41594-026-01806-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin

Browse structure collections

About this viewer

MolViewer shows 9LXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.